LL-37

LL-37's biological activity spans three functional categories: direct antimicrobial, immunomodulatory, and tissue-remodeling. Each operates through partially distinct mechanisms.

Direct Antimicrobial Mechanism (Membrane Disruption):

LL-37 is a cationic amphipathic alpha-helical peptide. In aqueous solution it exists as an unstructured random coil; upon contact with negatively charged target membranes (like bacterial outer and inner membranes), it folds into its characteristic alpha-helix and inserts into the lipid bilayer. Multiple mechanistic models describe the subsequent membrane disruption:

• Carpet model: LL-37 molecules accumulate parallel to the membrane surface ("carpet"), eventually destabilizing the entire lipid organization and causing membrane breakdown
• Toroidal pore model: LL-37 inserts perpendicular to the membrane, bringing lipid head groups with it and forming transmembrane pores that release contents and dissipate membrane potential
• Barrel-stave model: LL-37 forms multimeric transmembrane channels (less characterized for LL-37 specifically)

The practical result is rapid (minutes) membrane permeabilization and killing of susceptible organisms. Minimum inhibitory concentrations (MICs) range from 1-20 uM for many bacterial species in standardized assays, but MIC values are notably environment-dependent - LL-37 activity is dramatically reduced by physiological salt concentrations, certain serum components (albumin, lipopolysaccharide-binding protein), and host tissue secretions. This environmental sensitivity is a major translational challenge: what works powerfully in culture may have much weaker in vivo activity.

Target Specificity:

LL-37's preference for bacterial over mammalian membranes reflects:

• Bacterial membranes are rich in negatively charged lipids (phosphatidylglycerol, cardiolipin in bacteria vs phosphatidylcholine in mammals)
• Bacterial membranes lack cholesterol (which rigidifies mammalian membranes and reduces peptide insertion)
• Bacterial outer surfaces (LPS in gram-negatives, teichoic acids in gram-positives) bind cationic peptides
• Membrane potential differences favor peptide accumulation at bacterial membranes

However, this specificity is not absolute. At sufficient concentrations, LL-37 can damage mammalian cells - particularly those with altered membrane composition (cancer cells, apoptotic cells). This narrow therapeutic window is a primary reason systemic LL-37 development has been challenging.

Antiviral Activity:

LL-37 can inactivate enveloped viruses by disrupting viral envelope integrity. Documented activity against:

• Influenza A and B
• HIV (modestly)
• Vaccinia
• Herpes simplex
• Respiratory syncytial virus (RSV)
• SARS-CoV-2 (in vitro; clinical relevance uncertain)

Non-enveloped viruses are generally less susceptible because they lack the lipid envelope that LL-37 targets.

Antifungal Activity:

Active against Candida species and some filamentous fungi. Similar membrane-disruption mechanism.

Anti-Biofilm Activity:

LL-37 has documented activity against biofilm-embedded organisms, which is clinically relevant because conventional antibiotics often fail against biofilm infections. Mechanisms include disruption of quorum sensing, reduction of adhesion, and direct killing within biofilms.

Immunomodulatory Mechanisms (FPR2/ALX, P2X7, TLR):

LL-37 signals through multiple receptors on immune cells:

• FPR2/ALX (formyl peptide receptor 2): primary receptor for LL-37 chemotactic effects on neutrophils, monocytes, T cells, and mast cells
• P2X7 receptor: mediates some inflammatory effects and inflammasome activation
• EGFR (epidermal growth factor receptor): transactivation pathway contributing to wound healing
• TLR9 (intracellular): when LL-37 is complexed with self-DNA; relevant for psoriasis pathogenesis and certain antiviral responses

Downstream effects:

• Leukocyte chemotaxis
• Modulation of cytokine production (context-dependent; can both increase and decrease specific cytokines)
• Neutralization of LPS (reduces endotoxin-driven inflammation)
• Promotion of Th17 differentiation in certain contexts (relevant for psoriasis pathology)
• Activation of plasmacytoid dendritic cells (context-dependent - protective for acute infection, pathogenic in psoriasis)

Wound Healing Mechanisms:

LL-37 promotes wound repair through:

• Stimulation of keratinocyte migration and proliferation (re-epithelialization)
• Angiogenesis (via FPR2/ALX and EGFR transactivation; stimulation of VEGF production)
• Modulation of local immune response in wound bed
• Direct antimicrobial protection of wound surface

Pharmacokinetics:

• Endogenous LL-37 plasma concentrations: typically ~1-2 ug/mL (as hCAP18/LL-37) in healthy adults; vary with infection status, vitamin D status, and circadian rhythm
• Exogenous LL-37 administered subcutaneously: human pharmacokinetic data are sparse and not well characterized. The free peptide is cleared rapidly by proteolysis (effective circulating half-life on the order of ~30 minutes), while protein-bound hCAP18/LL-37 is more stable. Precise absorption and elimination parameters for injected LL-37 have not been established in controlled human studies
• Protein binding to serum albumin and other plasma proteins reduces free active concentration
• Cleared primarily through proteolytic degradation in tissues
• Tissue distribution favors mucosal surfaces and skin where endogenous production is highest

Vitamin D Connection:

The CAMP gene (encoding LL-37) has a vitamin D response element in its promoter. 1,25-dihydroxyvitamin D (calcitriol) upregulates LL-37 production substantially. This is one mechanism by which vitamin D supports immune function against tuberculosis and other infections. Vitamin D deficiency reduces endogenous LL-37 and may predispose to certain infections. This is also why vitamin D sufficiency (25-OH-D > 30-40 ng/mL) is considered baseline immune tuning - it supports endogenous LL-37 production without requiring exogenous peptide administration.

LL-37 is the only human cathelicidin, a 37-amino-acid amphipathic alpha-helical peptide ([LL-37, 37 aa]) cleaved from the C-terminus of the 170-amino-acid precursor hCAP-18 (human cationic antimicrobial protein, 18 kDa), which is encoded by the CAMP gene on chromosome 3p21.31. The "LL" in its name refers to the two leucine residues at the N-terminus; "37" is the length. LL-37 is stored in the secondary granules of neutrophils and produced by mucosal epithelial cells, keratinocytes, sebocytes, and certain lymphocyte populations, where it serves as a core component of the innate immune system — one of the evolutionarily ancient defenses that operates without requiring prior antigen exposure or adaptive immune priming. The peptide was first isolated in 1995 by Jürgen Gudmundsson, Birgitta Agerberth, and colleagues at the Karolinska Institute, and has since been the subject of more than 5,000 published studies exploring its roles in infection defense, wound healing, inflammation modulation, angiogenesis, and (paradoxically) inflammatory disease pathogenesis ([Gudmundsson et al., 1996], [Vandamme et al., 2012]).

LL-37's mechanism of antimicrobial action is fundamentally different from conventional antibiotics. Where small-molecule antibiotics target specific bacterial enzymes or structures (ribosomes, cell wall synthesis, DNA gyrase), LL-37 operates by direct physical disruption of microbial membranes. The peptide is cationic (net charge +6) and amphipathic — one face of the alpha-helix is hydrophobic, the other hydrophilic — which allows it to insert into negatively charged bacterial membranes (rich in phosphatidylglycerol and cardiolipin) while largely sparing mammalian cell membranes (rich in zwitterionic phosphatidylcholine and cholesterol). Once inserted, LL-37 forms transient pores, disrupts membrane potential, and kills the target organism. This mechanism is active against a broad spectrum — gram-positive and gram-negative bacteria, mycobacteria (including M. tuberculosis), fungi (Candida species), some enveloped viruses, and even biofilm-embedded organisms that resist conventional antibiotics ([Dürr et al., 2006]). Crucially, the membrane-disruption mechanism makes resistance development slower and more difficult than with molecular-target antibiotics — bacteria cannot easily redesign the bulk charge and composition of their membranes without compromising viability.

Beyond direct antimicrobial effects, LL-37 has important immunomodulatory roles. It recruits neutrophils, monocytes, T cells, and mast cells to sites of infection; modulates cytokine production by immune cells; promotes wound re-epithelialization and angiogenesis; and interacts with pattern-recognition receptors (TLR, FPR2/ALX, P2X7) to shape innate immune responses. This immunomodulation is largely protective, but LL-37 has also been implicated in the pathogenesis of certain chronic inflammatory conditions — most notably rosacea (where cathelicidin processing is dysregulated leading to pathological LL-37 fragments) and psoriasis (where LL-37 complexed with self-DNA activates plasmacytoid dendritic cells via TLR9, driving the Th17 inflammatory cascade characteristic of the disease). This dual role — protective in acute infection, pathogenic when dysregulated in chronic inflammatory disease — is a recurring theme in cathelicidin biology ([Yamasaki et al., 2007], [Lande et al., 2007]).

In clinical use, LL-37 has been investigated as a topical treatment for chronic infected wounds and diabetic foot ulcers (with some positive results in early trials but no approved product), as an adjunct to eradicate biofilm-related infections, and — more controversially in peptide-user communities — as a subcutaneous injection for systemic antimicrobial activity in chronic Lyme disease, chronic infections, and immune dysregulation syndromes. The peptide-community use is not supported by rigorous trial evidence, and the theoretical concerns are significant: systemic LL-37 at therapeutic antimicrobial concentrations has narrow margins between pharmacologic and toxic effects because the same membrane-disrupting activity that kills bacteria can also damage mammalian membranes at sufficient concentrations. LL-37 also has pro-inflammatory potential at certain doses and in certain disease contexts. This entry covers the established biology of LL-37, the legitimate research interest, and the considerable uncertainty around off-label human use ([Hilchie et al., 2013]).

LL-37 is frequently discussed alongside other peptides with overlapping or complementary roles. Cross-references include Thymosin-Alpha-1 for adaptive immune modulation, BPC-157 for tissue repair and vascular protection, and TB-500 for wound healing and actin biology. Unlike Tα1 which modulates host immunity to fight infection, LL-37 has direct antimicrobial activity — the two can be complementary in chronic infection contexts.

IUPAC Name

Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys... (37 amino acid sequence)

CAS Number

154947-66-7

Molecular Formula

C205H340N60O53S

Molecular Mass

4493.4 g/mol

Unlock the dosing protocols

Enter your email to keep reading. It is free, and it opens these tabs on every compound page in this browser.

• Dose, route, how often and how long
• A titration schedule
• Beginner, intermediate and advanced protocols
• Reconstitution and handling notes

You also get the free peptide cheat sheet by email. Unsubscribe anytime.

Have an account? Sign in

Unlock the research summary

Enter your email to keep reading. It is free, and it opens these tabs on every compound page in this browser.

• A summary of the key research
• Safety and side effects
• A link to the PubMed results

You also get the free peptide cheat sheet by email. Unsubscribe anytime.

Have an account? Sign in

Interaction Matrix

Related Compounds

Side-by-Side Comparisons

Related Articles

Disguised Alpha

$49.99($10.00/mg)

Data Completeness

COA Verification

Research Volume