LL-37 vs BPC-157
Side-by-side comparison of LL-37 and BPC-157: mechanism, half-life, dose range, safety profile, and live vendor pricing. Updated continuously as new research and listings land.
Live price snapshot
LL-37
BPC-157
LL-37
LL-37 is the only human cathelicidin, a 37-amino-acid amphipathic alpha-helical peptide (LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES) cleaved from the C-terminus of the 170-amino-acid precursor hCAP-18 (human cationic…
Live lowest price: $45.00 across 2 vendors
Full LL-37 profileBPC-157
BPC-157 (Body Protection Compound-157) is a synthetic pentadecapeptide consisting of 15 amino acids (Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val) derived from a partial sequence of human gastric juice…
Live lowest price: $29.00 across 17 vendors
Full BPC-157 profileSide-by-side comparison
| Attribute | LL-37 | BPC-157 |
|---|---|---|
| Category | Immune & Inflammation | Injury, Repair & Recovery |
| Research Stage | Clinical | Preclinical |
| Mechanism of Action | LL-37's biological activity spans three functional categories: direct antimicrobial, immunomodulatory, and tissue-remodeling. Each operates through partially distinct mechanisms. Direct Antimicrobial Mechanism (Membrane Disruption): LL-37 is a cationic… | Nitric Oxide (NO) System Modulation BPC-157 exerts a central integrative effect through modulation of the nitric oxide system. Studies by Seiwerth et al. (2022) demonstrated that BPC-157 counteracts both NO-excess and NO-deficiency states, functioning as a… |
| Half-Life | ~30 minutes (free peptide; rapidly cleared by proteolysis). Human pharmacokinetics of exogenous LL-37 are not well characterized. | Short plasma half-life. The first formal preclinical ADME study reported an elimination half-life under ~30 minutes after IV/IM dosing in rats and dogs, with linear dose-proportional kinetics (PMID: 36588717); a 2026 biopharmaceutical review confirms this sub-30-minute plasma half-life and highlights a pharmacokinetic-pharmacodynamic disconnect, as biological effects persist for hours to days (PMID: 42198317). No full human pharmacokinetic study has been published; twice-daily dosing is empirical/community-standard rather than PK-derived. |
| Typical Dose Range | — | 200-500 mcg subcutaneous 1-2x daily (community protocols); 1-10 mcg/kg in animal studies |
| Dosing Frequency | — | Twice daily (AM and PM) for optimal serum levels; once daily acceptable |
| Administration | — | Subcutaneous, Oral, Intraperitoneal, Intravenous |
| Side Effects | LL-37 has a less benign side-effect profile than many peptides covered in this guide, reflecting its mechanistic potency and narrow therapeutic window. Common (injection site): - Injection site irritation — more pronounced than with most peptides. Redness,… | Generally well-tolerated. Mild nausea or GI discomfort during initial use. Temporary increase in pain/inflammation at injury site (healing response). Rare: drowsiness, dizziness, mild headache. Very rare: transient changes in blood pressure. |
| Molecular Weight | 4493.4 g/mol | 1419.5 g/mol (average); molecular formula C62H98N16O22 |
| Common Vial Sizes | — | 5mg, 10mg |
Price History
3 data points- VANDL Labs
- Ion Peptide
- Disguised Alpha
Price History
8 data points- OF
- BM
- Unknown
- VANDL Labs
- Unknown
- LB
- Ion Peptide
- Disguised Alpha
LL-37 — potential benefits
- Broad-spectrum antimicrobial activity
- Wound healing acceleration
- Biofilm disruption
- Immune system modulation
- Anti-inflammatory effects
- Gut barrier support
BPC-157 — potential benefits
- Accelerated tendon and ligament healing with improved biomechanical strength in preclinical soft-tissue injury models (PMID: 30915550)
- Gastric and GI mucosal cytoprotection against ethanol-induced lesions, mediated in part by the nitric oxide system (PMID: 30279308)
- Healing of cysteamine-induced colitis and colon anastomosis in preclinical inflammatory bowel disease models (PMID: 24304574)
- Neuroprotection with dopaminergic and nitric oxide-system modulation in central nervous system injury models such as stroke and dopamine-receptor blockade (PMID: 34380875)
- Promotion of angiogenesis via VEGFR2 up-regulation, internalization, and VEGFR2-Akt-eNOS signaling in rat hind-limb ischemia and endothelial assays (PMID: 27847966)
- Tendon fibroblast outgrowth, cell survival, and migration through FAK-paxillin pathway activation (PMID: 21030672)
- Growth hormone receptor up-regulation in tendon fibroblasts, potentiating growth hormone's proliferative effect (PMID: 25415472)
- Nitric oxide-system interaction with endothelium protection, angiogenesis, and EGR-1-mediated growth-factor and collagen expression (PMID: 22300085)
Frequently asked
What's the difference between LL-37 and BPC-157?
LL-37 is a immune & inflammation that ll-37's biological activity spans three functional categories: direct antimicrobial, immunomodulatory, and tissue-remodeling. each operates through partially distinct mechanisms.…. BPC-157 is a injury, repair & recovery that nitric oxide (no) system modulation bpc-157 exerts a central integrative effect through modulation of the nitric oxide system. studies by seiwerth et al. (2022) demonstrated that…. The two differ in mechanism, half-life (~30 minutes (free peptide; rapidly cleared by proteolysis). Human pharmacokinetics of exogenous LL-37 are not well characterized. vs Short plasma half-life. The first formal preclinical ADME study reported an elimination half-life under ~30 minutes after IV/IM dosing in rats and dogs, with linear dose-proportional kinetics (PMID: 36588717); a 2026 biopharmaceutical review confirms this sub-30-minute plasma half-life and highlights a pharmacokinetic-pharmacodynamic disconnect, as biological effects persist for hours to days (PMID: 42198317). No full human pharmacokinetic study has been published; twice-daily dosing is empirical/community-standard rather than PK-derived.), and typical dose range.
Which has the longer half-life, LL-37 or BPC-157?
LL-37 has a half-life of ~30 minutes (free peptide; rapidly cleared by proteolysis). Human pharmacokinetics of exogenous LL-37 are not well characterized.. BPC-157 has a half-life of Short plasma half-life. The first formal preclinical ADME study reported an elimination half-life under ~30 minutes after IV/IM dosing in rats and dogs, with linear dose-proportional kinetics (PMID: 36588717); a 2026 biopharmaceutical review confirms this sub-30-minute plasma half-life and highlights a pharmacokinetic-pharmacodynamic disconnect, as biological effects persist for hours to days (PMID: 42198317). No full human pharmacokinetic study has been published; twice-daily dosing is empirical/community-standard rather than PK-derived.. Longer half-lives generally mean less frequent dosing but slower on/off kinetics.
Which is cheaper, LL-37 or BPC-157?
Current lowest live price on BodyHackGuide: LL-37 from $45.00, BPC-157 from $29.00. Prices are pulled from the vendor listings tracked on BHG and change frequently — see the compare tables on each compound page for the current set of offers.
Can you stack LL-37 and BPC-157?
Stacking depends on mechanism overlap, safety profile, and goals. LL-37 and BPC-157 should only be stacked after reviewing each compound's individual protocol page, side effect profile, and any published interaction data. Use the BodyHackGuide stack builder for a structured review before combining research compounds.
See current vendor prices
Live listings from the vendors we track, refreshed continuously.
Before you buy LL-37 or BPC-157
Check the vendor trust score. Every supplier we track is rated 0–100 on COA verification, payment transparency, shipping, reviews, and listings — one published, reproducible methodology, applied to every vendor including BHG Labs, which shares our ownership.
Related comparisons
Research use only. BodyHackGuide is a research and price-comparison reference. BodyHackGuide and BHG Labs share common ownership. The compounds discussed on this page are not approved by the FDA for human consumption and are sold strictly for laboratory research. Prices shown are pulled from vendor listings tracked on BHG and are subject to change. We earn an affiliate commission on some outbound clicks, and every vendor is ranked on the same public, reproducible methodology. See editorial standards and affiliate disclosure.