Skip to content

    Research Use Only

    This site is an independent educational resource for research compounds. We do not sell, distribute, or endorse human consumption of any compound. By entering, you confirm you are 21 years of age or older and agree to our Terms & Privacy Policy.

    🔬 100K+ researchers trust BodyHackGuide — Join r/BodyHackGuide

    LL-37 vs BPC-157

    Independent, side-by-side comparison of LL-37 and BPC-157: mechanism, half-life, dose range, safety profile, and live vendor pricing. Updated continuously as new research and listings land.

    LL-37 from $45.00
    BPC-157 from $29.00

    Live price snapshot

    LL-37

    Current low
    $45.00
    as of Apr 22, 2026
    7-day low
    $45.00
    30-day low
    $45.00
    30-day change
    baseline building

    BPC-157

    Current low
    $85.00
    as of Apr 22, 2026
    7-day low
    $29.00
    30-day low
    $29.00
    30-day change
    baseline building

    LL-37

    LL-37 is the only human cathelicidin, a 37-amino-acid amphipathic alpha-helical peptide (LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES) cleaved from the C-terminus of the 170-amino-acid precursor hCAP-18 (human cationic…

    Live lowest price: $45.00 across 1 vendor

    Full LL-37 profile

    BPC-157

    Featured

    BPC-157 (Body Protection Compound-157) is a synthetic pentadecapeptide consisting of 15 amino acids (Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val) derived from a partial sequence of human gastric juice…

    Live lowest price: $29.00 across 15 vendors

    Full BPC-157 profile

    Side-by-side comparison

    Attribute LL-37 BPC-157
    Category Immune & Inflammation Injury, Repair & Recovery
    Research Stage Preclinical Preclinical
    Mechanism of Action LL-37's biological activity spans three functional categories: direct antimicrobial, immunomodulatory, and tissue-remodeling. Each operates through partially distinct mechanisms. Direct Antimicrobial Mechanism (Membrane Disruption): LL-37 is a cationic… Nitric Oxide (NO) System Modulation BPC-157 exerts a central integrative effect through modulation of the nitric oxide system. Studies by Seiwerth et al. (2022) demonstrated that BPC-157 counteracts both NO-excess and NO-deficiency states, functioning as a…
    Half-Life ~4 hours (estimated from animal pharmacokinetic data)
    Typical Dose Range 200-500 mcg subcutaneous 1-2x daily (community protocols); 1-10 mcg/kg in animal studies
    Dosing Frequency Twice daily (AM and PM) for optimal serum levels; once daily acceptable
    Administration Subcutaneous, Oral, Intraperitoneal, Intravenous
    Side Effects LL-37 has a less benign side-effect profile than many peptides covered in this guide, reflecting its mechanistic potency and narrow therapeutic window. Common (injection site): - Injection site irritation — more pronounced than with most peptides. Redness,… Generally well-tolerated. Mild nausea or GI discomfort during initial use. Temporary increase in pain/inflammation at injury site (healing response). Rare: drowsiness, dizziness, mild headache. Very rare: transient changes in blood pressure.
    Molecular Weight 4493.4 g/mol 1419.56 g/mol
    Common Vial Sizes 5mg, 10mg

    Price History

    2 data points
    • VANDL Labs
    • Ion Peptide

    Price History

    6 data points
    • OF
    • Unknown
    • Nova Peptides
    • VANDL Labs
    • Adera
    • LB
    • Ion Peptide

    LL-37 — potential benefits

    • Broad-spectrum antimicrobial activity
    • Wound healing acceleration
    • Biofilm disruption
    • Immune system modulation
    • Anti-inflammatory effects
    • Gut barrier support

    BPC-157 — potential benefits

    • Accelerated tendon and ligament healing with improved biomechanical strength (PMID: 30915550)
    • Gastric mucosal protection against NSAID-induced and ethanol-induced lesions (PMID: 29898088)
    • Gut healing in inflammatory bowel disease (IBD) preclinical models (PMID: 29898088)
    • Neuroprotection in dopaminergic and serotonergic neurotoxicity models (PMID: 21524250)
    • Promotion of angiogenesis via VEGFR2 upregulation in damaged tissues (PMID: 36416831)
    • Wound healing acceleration through EGR-1 and FAK-paxillin pathway activation (PMID: 21524250)
    • Growth hormone receptor upregulation enhancing local GH/IGF-1 signaling (PMID: 30175840)
    • Bidirectional nitric oxide system stabilization protecting against vascular injury (PMID: 36416831)

    Frequently asked

    What's the difference between LL-37 and BPC-157?

    LL-37 is a immune & inflammation that ll-37's biological activity spans three functional categories: direct antimicrobial, immunomodulatory, and tissue-remodeling. each operates through partially distinct mechanisms.…. BPC-157 is a injury, repair & recovery that nitric oxide (no) system modulation bpc-157 exerts a central integrative effect through modulation of the nitric oxide system. studies by seiwerth et al. (2022) demonstrated that…. The two differ in mechanism, half-life (not reported vs ~4 hours (estimated from animal pharmacokinetic data)), and typical dose range.

    Which has the longer half-life, LL-37 or BPC-157?

    LL-37 has a half-life of not reported. BPC-157 has a half-life of ~4 hours (estimated from animal pharmacokinetic data). Longer half-lives generally mean less frequent dosing but slower on/off kinetics.

    Which is cheaper, LL-37 or BPC-157?

    Current lowest live price on BodyHackGuide: LL-37 from $45.00, BPC-157 from $29.00. Prices are pulled from the vendor listings tracked on BHG and change frequently — see the compare tables on each compound page for the current set of offers.

    Can you stack LL-37 and BPC-157?

    Stacking depends on mechanism overlap, safety profile, and goals. LL-37 and BPC-157 should only be stacked after reviewing each compound's individual protocol page, side effect profile, and any published interaction data. Use the BodyHackGuide stack builder for a structured review before combining research compounds.

    See current vendor prices

    Live listings from the vendors we track, refreshed continuously.

    LL-37 prices BPC-157 prices Compare all compounds

    Related comparisons

    retatrutide vs tirzepatideretatrutide vs semaglutidetirzepatide vs semaglutidebpc 157 vs tb 500cjc 1295 vs ipamorelin

    Research use only. BodyHackGuide is an independent research reference. The compounds discussed on this page are not approved by the FDA for human consumption and are sold strictly for laboratory research. Prices shown are pulled from vendor listings tracked on BHG and are subject to change. We earn an affiliate commission on some outbound clicks — this never affects the data or pricing shown. See editorial standards and affiliate disclosure.