
Also known as: Ta1
Thymosin alpha-1 (Tα1) is a 28-amino-acid N-acetylated peptide (N-Ac-Ser-Asp-Ala-Ala-Val-Asp-Thr-Ser-Ser-Glu-Ile-Thr-Thr-Lys-Asp-Leu-Lys-Glu-Lys-Lys-Glu-Val-Val-Glu-Glu-Ala-Glu-Asn) isolated and characterized by Allan Goldstein's laboratory at George Washington University in the 1970s as the immunologically active cleavage product of a larger precursor (prothymosin alpha) found in thymic tissue. The thymus gland is the primary site of T-cell maturation in early life, and thymic hormones have long been implicated in immune competence.
Overview
At A Glance
Thymosin alpha-1 does not act through a single canonical receptor in the way many peptides do. Its mechanism is pleiotropic, involving pattern-recognition receptors, modulation of immune cell maturation and function, and shifts in cytokine signaling patterns.…
Mechanism of Action
Thymosin alpha-1 does not act through a single canonical receptor in the way many peptides do. Its mechanism is pleiotropic, involving pattern-recognition receptors, modulation of immune cell maturation and function, and shifts in cytokine signaling patterns.
Primary Receptor Interaction — Toll-Like Receptors (TLRs): Tα1's most characterized mechanism involves binding to TLR9 and TLR2 on dendritic cells, monocytes, and plasmacytoid dendritic cells ([Romani et al., 2004]). These TLRs normally respond to bacterial and viral pathogen-associated molecular patterns (unmethylated CpG DNA for TLR9, lipopeptides for TLR2). Tα1 engagement activates MyD88-dependent and TRIF-dependent signaling pathways downstream, driving NF-κB activation, IRF3/IRF7 activation, and transcriptional programs that include:
- Dendritic cell maturation (MHC II upregulation, costimulatory molecule expression)
- Type I interferon (IFN-α/β) production
- IL-12 production driving Th1 polarization
- Enhanced antigen presentation to T cells
T-Cell Maturation and Function: Tα1 promotes differentiation of T-cell precursors from both thymic and extra-thymic origins. Specific effects:
- Increased CD4+ and CD8+ T-cell counts in lymphopenic states
- Improved CD4/CD8 ratio in aging or immunocompromised patients
- Enhanced proliferative response to antigens and mitogens
- Reduced T-cell exhaustion markers in chronic viral infection contexts
- Shift toward Th1 cytokine profile (IFN-γ, IL-2) with relative suppression of Th2 (IL-4, IL-10) in Th2-dominant inflammatory states, and complementary rebalancing in Th1-dominant states
Natural Killer (NK) Cell Activation: Tα1 enhances NK cell cytotoxicity and interferon-γ production. NK cells are critical for early antiviral response and for tumor surveillance, and Tα1's NK-improving effects are one of the motivations for its use in viral hepatitis and cancer-adjunct settings.
Regulatory T-Cell (Treg) Modulation: Tα1 modulates regulatory T-cell function in a context-dependent way — in chronic infection or cancer contexts where Treg over-expansion suppresses useful antiviral/antitumor responses, Tα1 can reduce Treg dominance; in autoimmune-prone contexts where pathological Teffector dominance drives disease, Tα1 may preserve Treg balance. This context-dependent modulation is why Tα1 can be used in settings ranging from immune suppression (infection) to autoimmune-related fatigue without producing predictable harm in either direction.
Cytokine and Inflammation Modulation:
- Reduces TNF-α and IL-6 in inflammatory contexts (acute-phase response modulation)
- Increases IL-2 and IFN-γ in antiviral response contexts
- Modulates IL-10 and TGF-β for balanced immune responses
- Reduces pro-inflammatory signaling in sepsis and severe viral pneumonia ([Liu et al., 2020])
Anti-apoptotic and Cytoprotective Effects: Tα1 reduces lymphocyte apoptosis in chronic viral infection contexts (where viruses drive T-cell exhaustion and death) and protects dendritic cells from pathogen-induced death, preserving immune architecture during severe infection.
Pharmacokinetics:
- Subcutaneous Tα1 peak plasma concentration: 1-2 hours post-dose
- Elimination half-life: 2-3 hours
- Clearance: primarily through renal filtration after tissue distribution
- Bioavailability: requires injection (SC or IV); no oral bioavailability due to peptidase degradation
- Duration of biological effect extends well beyond plasma half-life due to downstream cellular activation (dendritic cell maturation takes 24-48 hours; T-cell effects measured over days)
Dose-Response: Tα1 effects do not follow a simple linear dose-response. The clinical standard of 1.6 mg twice weekly (or 900 μg daily) has been optimized through decades of trials in approved indications. Higher doses do not necessarily produce better immune response and may shift Tα1 activity profile in unintended ways. Dose tuning for each off-label indication remains an area of ongoing research.
What Tα1 Is Not:
- Not a generalized immune "booster" — it shifts immune response patterns rather than amplifying all immune activity
- Not an immunosuppressant — does not broadly suppress immune function like corticosteroids or calcineurin inhibitors
- Not a vaccine adjuvant in the direct sense (though used alongside vaccines to improve response in immunocompromised patients)
- Not antiviral directly — does not bind viruses or inhibit viral replication; acts through host immune enhancement
Overview
Thymosin alpha-1 (Tα1) is a 28-amino-acid N-acetylated peptide (N-Ac-Ser-Asp-Ala-Ala-Val-Asp-Thr-Ser-Ser-Glu-Ile-Thr-Thr-Lys-Asp-Leu-Lys-Glu-Lys-Lys-Glu-Val-Val-Glu-Glu-Ala-Glu-Asn) isolated and characterized by Allan Goldstein's laboratory at George Washington University in the 1970s as the immunologically active cleavage product of a larger precursor (prothymosin alpha) found in thymic tissue. The thymus gland is the primary site of T-cell maturation in early life, and thymic hormones have long been implicated in immune competence. Goldstein's isolation of Tα1 opened decades of research into whether supplementation with thymic peptides could restore immune function in contexts of thymic atrophy (aging, chemotherapy, HIV, chronic viral infection) or augment immune response against infections and malignancies. Synthetic Tα1 (under the brand name Zadaxin, manufactured by SciClone Pharmaceuticals) has been approved in more than 30 countries for chronic hepatitis B, chronic hepatitis C, and as an immune adjuvant for influenza and hepatitis B vaccines in immunocompromised patients, as well as adjunctive therapy in certain cancers. In the United States, Tα1 is not FDA-approved but has held orphan drug designation for several indications and is commonly available through compounding pharmacies for off-label use ([Goldstein et al., 1977], [Garaci et al., 2003]).
The mechanistic framing for Tα1 is best understood as a pleiotropic immune modulator rather than a simple immune "booster." Tα1 acts primarily through Toll-like receptors (especially TLR9 and TLR2) on dendritic cells and other antigen-presenting cells, driving dendritic cell maturation, promoting balanced Th1/Th2 responses, improving T-cell differentiation from thymic and extra-thymic precursors, stimulating natural killer cell activity, and modulating inflammatory cytokine patterns. The practical result in patients with chronic viral infections or immunocompromise is improved viral clearance, enhanced vaccine response, and more balanced immune reactivity. Importantly, Tα1 does not produce generalized immune activation or autoimmunity at therapeutic doses — it shifts immune response patterns rather than simply amplifying inflammation. This selective modulation is what has made Tα1 clinically attractive in contexts where straightforward immune activation would cause harm ([Romani et al., 2012], [Li et al., 2010]).
In everyday off-label use outside strictly approved indications, Tα1 is pursued by three main user groups. First, people with chronic viral infections (EBV reactivation, chronic Lyme complex, long COVID, chronic hepatitis, HIV as adjunct to antiretrovirals) use Tα1 for immune support alongside primary therapy. Second, older adults with age-related thymic atrophy and declining CD4/CD8 ratios use Tα1 as a general immunity-preservation strategy, often in combination with other longevity-oriented peptides like BPC-157 and Epithalon. Third, cancer patients in remission or undergoing certain immunotherapies use Tα1 as adjunctive immune support, ideally under oncologic supervision. Competitive athletes sometimes use Tα1 during heavy training cycles on the theory that exercise-induced transient immune suppression can be buffered, though this use case has weak formal evidence ([Garaci et al., 2007]).
Tα1 has one of the cleanest safety profiles among peptides with substantial bioactivity — decades of clinical use with minimal adverse events, no significant organ toxicity, and no autoimmunity signal at therapeutic doses. The main practical limitations are the cost of good-quality Tα1 preparations, the injectable route (Tα1 is not orally bioavailable), and the uncertainty around whether long-term routine supplementation meaningfully delays age-related immune decline in healthy individuals. This entry covers Tα1's established mechanism and indications, the emerging research in long COVID and other post-viral syndromes, and the practical considerations for anyone exploring Tα1 for immune support. Related peptides frequently stacked or compared include BPC-157 and TB-500 for general tissue repair, Epithalon for parallel longevity positioning, and LL-37 for a very different (antimicrobial rather than immune-modulating) peptide category.
Potential Research Fields
Chemical Information
IUPAC Name
L-seryl-L-alpha-aspartylL-alanyl-L-alanyl-L-valyl-L-alpha-aspartyl-L-threonyl... (28 aa sequence)
CAS Number
62304-98-7
Molecular Formula
C129H215N33O55
Molecular Mass
3108.3 g/mol
Amino Acid Sequence
Dosing & Protocols
Unlock the dosing protocols
Enter your email to keep reading. It is free, and it opens these tabs on every compound page in this browser.
- Dose, route, how often and how long
- A titration schedule
- Beginner, intermediate and advanced protocols
- Reconstitution and handling notes
You also get the free peptide cheat sheet by email. Unsubscribe anytime.
Have an account? Sign in
Research
Unlock the research summary
Enter your email to keep reading. It is free, and it opens these tabs on every compound page in this browser.
- A summary of the key research
- Safety and side effects
- A link to the PubMed results
You also get the free peptide cheat sheet by email. Unsubscribe anytime.
Have an account? Sign in
Interactions
Interaction Matrix
Contraindications
Absolute contraindications:
- Organ transplant recipients on maintenance immunosuppression (Tα1's immune activation could trigger rejection)
- Active hypersensitivity to Tα1 preparations
- Pregnancy (no adequate safety data)
- Breastfeeding (no data)
- Acute hyperinflammatory states (severe cytokine storm, uncontrolled sepsis in late phase) — requires specialist assessment
Strong relative contraindications:
- Poorly controlled autoimmune disease (lupus, rheumatoid arthritis, multiple sclerosis, Hashimoto's thyroiditis with significant inflammation) — risk of flare; only use under rheumatology/specialist supervision
- Recent organ transplantation
- Active hematologic malignancy (requires oncology direction)
- Concurrent high-dose systemic corticosteroid therapy (pharmacologically opposed effect; limited benefit)
- Concurrent cytotoxic chemotherapy (effects may be altered; coordination with oncology essential)
Drug interactions:
- Immunosuppressants (methotrexate, azathioprine, cyclosporine, tacrolimus, biologics): Pharmacologic antagonism; discuss with prescribing physician before combining.
- High-dose corticosteroids (chronic prednisone >20 mg/day): May neutralize Tα1 effects; pharmacologic antagonism.
- Cytotoxic chemotherapy: Complex interactions; only under oncology direction.
- Interferon preparations: Generally synergistic (standard use in hepatitis), but monitor cytokine-related side effects.
- Checkpoint inhibitors (nivolumab, pembrolizumab): Potentially synergistic (active research); discuss with oncology.
- Live attenuated vaccines: Tα1 may improve vaccine response (potentially useful) but also theoretically increase risk of vaccine-derived adverse events in immunocompromised patients; discuss with prescribing clinician.
Stop using if:
- Signs of allergic reaction (hives, facial swelling, difficulty breathing)
- Severe injection site reaction persistent beyond 48 hours
- Unexplained worsening of an underlying autoimmune condition
- Development of new autoimmune symptoms (unexplained joint pain, rashes, fatigue patterns)
- Signs of organ transplant rejection (if inadvertently used)
- Pregnancy (confirmed or suspected)
- New cancer diagnosis (reassess with oncology)
Monitoring:
- Baseline (recommended before longer courses): CBC with differential, CD4/CD8 ratio, complete metabolic panel, CRP, 25-OH vitamin D, ferritin. Consider viral serologies if chronic infection suspected.
- During therapy: symptom tracking; repeat CBC and CD4/CD8 at 8-12 weeks if clinically relevant
- End of course: repeat relevant labs to document response
- For autoimmunity patients: ANA, specific auto-antibodies at baseline and if new symptoms develop
Special Caution Scenarios:
- Users on multiple peptide protocols should layer in Tα1 after establishing baseline responses to other peptides; sudden addition of multiple immune-modulating compounds complicates adverse-event attribution
- Users with vague chronic illness should consider full workup before multi-month Tα1 protocols; some underlying conditions (malignancy, structural problems) benefit from early direct treatment rather than immune modulation
- In competitive athletes: verify current WADA / sport-specific drug testing status; Tα1 is not explicitly prohibited but has been discussed in monitoring contexts
Medical Supervision: Tα1 benefits significantly from clinician supervision for anything beyond short-term basic use. Chronic viral infection, long COVID, cancer-adjunctive contexts, and autoimmune-adjacent conditions all benefit from professional oversight. Functional medicine and integrative medicine practices are common sources of support for Tα1-inclusive protocols.
Research Disclaimer
This interaction data is compiled from published research and community reports. It may not be exhaustive. Always consult a healthcare professional before combining compounds.
$39.99
up to $49.99
$4.4990
4
4
vial
Tracking since Mar 13, 2026 · 3 data points
Price History
3 data pointsVendors Selling Thymosin Alpha-1 (TA1)

VANDL Labs

Optimum Formula

ResearchChemHQ

Disguised Alpha
How we score these vendors
Every supplier above is graded 0 to 100 on COA verification, payment transparency, shipping, reviews, and active listings. Methodology published, no pay-to-rank.
Related Compounds
View AllLarazotide (AT-1001)
Immune & InflammationPhase 3Larazotide is an eight amino acid peptide with the sequence glycine-glycine-valine-leucine-valine-glutamine-proline-glycine, usually supplied as the acetate salt.
LL-37
Immune & InflammationPhase 2LL-37 is the only human cathelicidin, a 37-amino-acid amphipathic alpha-helical peptide ([LL-37, 37 aa]) cleaved from the C-terminus of the 170-amino-acid precursor hCAP-18 (human cationic antimicrobial protein, 18 kDa), which is encoded by the CAMP gene on chromosome 3p21.31.
Side-by-Side Comparisons
All ComparisonsView Full Dosage Guide →
Protocols, calculator & safety for Thymosin Alpha-1 (TA1)
Research Score
701 PubMed results
Quality Indicators
Data Completeness
100%COA Verification
10
Verified COAs
2
Vendors w/ COA
High verification rate (83%)
Latest test: 3/1/2026
Research Volume
Well-researched compound
Quick Facts
Half-Life
~2 hours
Molecular Weight
3108.3 g/mol
Administration
Subcutaneous
CAS Number
62304-98-7
Trial Phase
FDA Approved
Safety Profile
Low RiskCommon Side Effects
- • Mild injection site reactions
- • Transient fatigue
- • Flu-like symptoms (early doses)
Stop Use If
- Active autoimmune disease (consult physician)
- Organ transplant recipients on immunosuppression
Research Disclaimer
This information is for educational and research purposes only. Not intended as medical advice. Consult a healthcare professional before use.
Frequently Asked Questions
What does Tα1 actually do to my immune system?
Tα1 is best understood as an immune modulator rather than an immune booster. It engages Toll-like receptors (primarily TLR9 and TLR2) on dendritic cells and other antigen-presenting cells, driving dendritic cell maturation, enhanced T-cell differentiation, improved natural killer cell function, and balanced cytokine patterns. Practically this means better response to viral infections, improved vaccine response in immunocompromised states, and more coordinated immune activity in chronic illness. It doesn't broadly activate inflammation or cause autoimmunity — the effect is to shift immune response patterns toward more effective and balanced activity.
Is Tα1 the same thing as 'thymosin beta-4' (TB-500)?
No. Tα1 and TB-500 are completely different peptides with different functions despite similar naming. Tα1 is a 28-amino-acid immune-modulating peptide derived from the thymus gland. TB-500 (thymosin beta-4) is a 43-amino-acid peptide with actin-regulating and tissue-repair functions; it's used primarily for healing, recovery, and musculoskeletal injuries rather than immune modulation. They can be stacked without interaction (as with BPC-157, TB-500, and Tα1 combinations common in wellness protocols), but their indications are different.
How long does it take to feel Tα1 working?
Most effects are subtle and emerge over 4-8 weeks rather than within hours or days. Tα1 doesn't produce acute noticeable sensations from individual doses. What improves over weeks: fewer and shorter infections, improved recovery from illness, better energy in chronic fatigue contexts, improved lab markers (CD4/CD8 ratio, lymphocyte counts, response to vaccines). If you're expecting dramatic acute effects, you'll be disappointed; if you're using Tα1 for sustained immune support with appropriate time horizons, benefits typically emerge over weeks to months of consistent dosing.
Can Tα1 help with long COVID?
There's emerging evidence suggesting benefit in a subset of long COVID patients, particularly those with documented immune dysregulation (low lymphocyte counts, skewed CD4/CD8 ratios, evidence of viral reactivation). Observational studies and small trials have reported improvements in fatigue, post-exertional malaise, and immune function. Rigorous large trials are ongoing. Realistic framing: Tα1 is not a long COVID cure and should be part of broader treatment including graded activity, sleep optimization, autonomic management, nutritional support, and any indicated specific treatments. Many long COVID protocols include Tα1 alongside low-dose naltrexone, NAC, and mitochondrial support.
Do I need a prescription for Tα1?
In the US, Tα1 is not FDA-approved for general market sale but can be obtained through compounding pharmacies with a physician prescription. It is widely available through peptide vendors (research-chemical classification) without prescription but at variable quality. Brand-name Zadaxin is approved and sold in many countries outside the US. For best quality and safety, compounding pharmacy with physician oversight is the preferred path. For cost-sensitive use, peptide-vendor sourcing is common but requires careful vendor selection and ideally third-party testing verification.
Will Tα1 trigger autoimmune disease?
There's a theoretical concern since Tα1 activates immune response, but 45+ years of clinical use in hundreds of thousands of patients has not shown a clear autoimmunity signal. In users with preexisting autoimmune disease, Tα1 could theoretically trigger flares — so anyone with lupus, rheumatoid arthritis, MS, or other autoimmune conditions should discuss with their rheumatologist before starting. In healthy users, the autoimmunity risk appears very low but not zero. Monitor for new unexplained symptoms (persistent joint pain, rashes, fatigue patterns, unexpected lab changes). Stop if concerning symptoms emerge and consult a clinician.
Can I use Tα1 alongside chemotherapy or cancer treatment?
This is an oncology supervision question — never self-direct Tα1 alongside cancer treatment. There is research interest in combining Tα1 with checkpoint inhibitors (potential synergy), and some historical use alongside traditional chemotherapy, but timing, dosing, and combination choices significantly affect outcomes. Tα1 could theoretically help (by supporting immune function during chemotherapy-induced immunosuppression) or hurt (by interfering with specific cancer-treatment mechanisms). Only integrative oncology clinicians familiar with both Tα1 and your specific cancer context should guide this decision.
Is daily Tα1 or twice-weekly Tα1 better?
Both schedules are supported by clinical evidence with different contexts. Twice-weekly 1.6 mg (the Zadaxin approved regimen) is appropriate for long-term maintenance and most chronic indications; it's easier to sustain and has the most clinical evidence. Daily 900 μg is used for more intensive acute or intermediate-term support (post-viral recovery, severe immunocompromise). There's no clear evidence that daily is superior to twice-weekly for long-term use, and the higher total dose adds cost without proportional benefit for most indications. For chronic maintenance, twice-weekly is typical; for intensive 4-8 week courses during acute illness recovery, daily can be appropriate.
How does Tα1 compare to other immune-support approaches?
Tα1 has a specific mechanism (dendritic cell and T-cell modulation via TLR signaling) that isn't replicated by other commonly used immune supports. Vitamin D, zinc, vitamin C, elderberry, and similar nutritional approaches support baseline immune function but don't specifically activate adaptive immune maturation pathways. NAC supports glutathione and has antioxidant effects. LDN modulates opioid receptors with downstream immune effects. These can all be complementary to Tα1 rather than substitutes. That said, for many users with general wellness goals and no specific indication, optimizing vitamin D (25-OH-D > 40 ng/mL), zinc adequacy, sleep, and nutrition likely delivers more benefit than adding Tα1 without specific reason.
Does Tα1 help with aging immune decline?
Mechanistically plausible and partly supported. The thymus involutes with age (thymic tissue is largely replaced by fat by middle age), and thymus-derived immune peptides decline. Supplementing with synthetic Tα1 addresses some of this loss. Small studies have shown improved lymphocyte counts, CD4/CD8 ratios, and vaccine response in older adults on Tα1 courses. Clinical endpoints (infection rates, mortality) have not been rigorously studied in healthy aging populations, so the translation from mechanistic rationale to real-world benefit in healthy older adults is uncertain. Tα1 for aging immunity is reasonable as part of a broader longevity protocol (alongside Epithalon, BPC-157, and lifestyle factors) but shouldn't be framed as proven to extend lifespan.
Research Tools
Related Compounds
View AllLarazotide (AT-1001)
Immune & InflammationPhase 3Larazotide is an eight amino acid peptide with the sequence glycine-glycine-valine-leucine-valine-glutamine-proline-glycine, usually supplied as the acetate salt.
LL-37
Immune & InflammationPhase 2LL-37 is the only human cathelicidin, a 37-amino-acid amphipathic alpha-helical peptide ([LL-37, 37 aa]) cleaved from the C-terminus of the 170-amino-acid precursor hCAP-18 (human cationic antimicrobial protein, 18 kDa), which is encoded by the CAMP gene on chromosome 3p21.31.
Side-by-Side Comparisons
All ComparisonsCompare Thymosin Alpha-1 (TA1) head-to-head: mechanism, half-life, dosing, safety, and vendor prices.
Free 2026 Peptide Cheat Sheet (PDF)
38 compounds and blends: vial sizes, BAC water volumes, dosing ranges and bloodwork markers.