
Larazotide (AT-1001)
Immune & InflammationPhase 3Also known as: Larazotide acetate, AT-1001, AT1001, AT-2347, INN-202
Larazotide is an eight amino acid peptide with the sequence glycine-glycine-valine-leucine-valine-glutamine-proline-glycine, usually supplied as the acetate salt. Its structure derives from a protein secreted by Vibrio cholerae, the zonula occludens toxin, and it was developed as an antagonist at that pathway rather than as an agonist.
Overview
At A Glance
Larazotide is a tight junction regulator, described as a zonulin antagonist. Zonulin signaling opens the paracellular space between intestinal epithelial cells; larazotide acts in the gut lumen to block that opening and to promote reassembly of tight junctions, with redistributio…
Overview
Larazotide is an eight amino acid peptide with the sequence glycine-glycine-valine-leucine-valine-glutamine-proline-glycine, usually supplied as the acetate salt. Its structure derives from a protein secreted by Vibrio cholerae, the zonula occludens toxin, and it was developed as an antagonist at that pathway rather than as an agonist. Alba Therapeutics took it into celiac disease (PMID: 17697209), and it was later developed by 9 Meters Biopharma under the code INN-202 (NCT03569007). It is not approved anywhere. The target is the intestinal tight junction. In celiac disease, gluten peptides reach the lamina propria and trigger an immune response, and increased paracellular permeability is one route by which they get there. Larazotide acts locally in the gut lumen to keep tight junctions closed. Mechanistic work links it to redistribution and rearrangement of tight junction proteins and actin filaments, and more recently to inhibition of myosin light chain kinase, which reduces tension on actin filaments and lets the junction close (PMID: 33881350). Because it works in the lumen and is taken orally, it is not designed to reach the systemic circulation. Animal work supports the barrier mechanism outside celiac disease. In interleukin 10 gene-deficient mice, treatment reduced small intestinal permeability and attenuated colitis, with lower colonic tumor necrosis factor alpha secretion at 17 weeks (PMID: 18829978). In pigs, it induced recovery of ischemia-injured jejunum through repair of tight junctions (PMID: 33886649). Rat studies report reduced intestinal permeability and bacterial translocation in acute pancreatitis (PMID: 38441784) and reduced liver and intestinal damage in acute liver failure (PMID: 34791921). The human record is unusually complete for a compound sold as a research chemical, and it is mixed. A proof of concept study in celiac disease subjects challenged with gluten found no increase in adverse events, no rise in intestinal permeability in the treated group against a 70 percent rise on placebo, and fewer gastrointestinal symptoms (PMID: 17697209). Two gluten-challenge trials in 86 and 184 patients failed to separate from placebo on the lactulose to mannitol permeability ratio, but reported reductions in symptoms and, in the larger trial, lower anti-transglutaminase antibody rises (PMID: 22825365, PMID: 23163616). A 342-patient phase 2b trial in patients who still had symptoms on a gluten-free diet met its primary symptom endpoint at the lowest dose tested and not at higher doses (PMID: 25683116). The phase 3 trial then stopped: NCT03569007 enrolled 307 patients and was terminated in 2022 after a pre-specified interim analysis indicated that the number of additional patients needed to show a significant clinical effect was too large to continue (NCT03569007; sponsor announcement, June 2022). Interest has since moved to other barrier-driven conditions. A phase 2a randomized trial in 12 children with multisystem inflammatory syndrome after COVID-19 reported no larazotide-related adverse events, faster clearance of circulating SARS-CoV-2 spike antigen and faster resolution of gastrointestinal symptoms (PMID: 40737433). A long COVID phase 2a trial has completed (NCT05747534). What is sold as a research chemical capsule is an investigational drug, not an approved medicine.
Potential Research Fields
Chemical Information
IUPAC Name
Not yet available
CAS Number
258818-34-7
Molecular Formula
C32H55N9O10
Molecular Mass
725.85 g/mol (free peptide)
Dosing & Protocols
Unlock Dosing Protocols
Free account gets you:
- View beginner, intermediate & advanced protocols
- See weight-based dosing calculations
- Access cycle length & frequency data
2,800+ researchers already in
Research
Unlock Research Data
Free account gets you:
- Browse PubMed study summaries
- See clinical trial phases & results
- Access mechanism of action details
2,800+ researchers already in
Interactions
Contraindications
No pharmacological contraindications have been established in the published trials. Mechanism-based caution: larazotide does not treat celiac disease and does not make gluten safe to eat. In every trial, patients stayed on a gluten-free diet or were given a controlled gluten challenge under supervision, and the compound was studied as an addition to the diet, not a replacement for it (PMID: 25683116). Trial exclusion criteria in the phase 3 study covered refractory celiac disease, severe complications of celiac disease and chronic active gastrointestinal disease other than celiac disease (NCT03569007).
Research Disclaimer
This interaction data is compiled from published research and community reports. It may not be exhaustive. Always consult a healthcare professional before combining compounds.
$99.99
—
1
1
capsule
| Vendor | Product | Form | Qty | Price | $/mg | Coupon | |
|---|---|---|---|---|---|---|---|
![]() |
Larazotide capsules (60) | capsule | 60 capsules● In Stock | $99.99BEST | — | — |
Tracking since Sep 7, 2026 · 1 data point
Vendors Selling Larazotide (AT-1001)
How we score these vendors
Every supplier above is graded 0–100 on COA verification, payment transparency, shipping, reviews, and active listings. Methodology published, no pay-to-rank.
Related Compounds
View AllLL-37
Immune & InflammationPhase 2LL-37 is the only human cathelicidin, a 37-amino-acid amphipathic alpha-helical peptide ([LL-37, 37 aa]) cleaved from the C-terminus of the 170-amino-acid precursor hCAP-18 (human cationic antimicrobial protein, 18 kDa), which is encoded by the CAMP gene on chromosome 3p21.31.
Thymosin Alpha-1 (TA1)
Immune & InflammationFDA ApprovedThymosin alpha-1 (Tα1) is a 28-amino-acid N-acetylated peptide (N-Ac-Ser-Asp-Ala-Ala-Val-Asp-Thr-Ser-Ser-Glu-Ile-Thr-Thr-Lys-Asp-Leu-Lys-Glu-Lys-Lys-Glu-Val-Val-Glu-Glu-Ala-Glu-Asn) isolated and characterized by Allan Goldstein's laboratory at George Washington University in the 1970s as the immunologically active cleavage product of a larger precursor (prothymosin alpha) found in thymic tissue.
View Full Dosage Guide →
Protocols, calculator & safety for Larazotide (AT-1001)
Research Score
0 PubMed studies
Quality Indicators
Data Completeness
63%Quick Facts
Half-Life
Not established as a systemic value. Larazotide is designed to act locally in the intestinal lumen and is given orally rather than for systemic exposure (PMID: 33881350); single-dose safety, tolerance and pharmacokinetics were assessed in a phase 1b study in celiac disease subjects (PMID: 17697209)
Molecular Weight
725.85 g/mol (free peptide)
Administration
Oral
CAS Number
258818-34-7
Trial Phase
Phase 3
Research Disclaimer
This information is for educational and research purposes only. Not intended as medical advice. Consult a healthcare professional before use.
Frequently Asked Questions
What is Larazotide (AT-1001) used for in research?
Larazotide is an eight amino acid peptide with the sequence glycine-glycine-valine-leucine-valine-glutamine-proline-glycine, usually supplied as the acetate salt. Its structure derives from a protein secreted by Vibrio cholerae, the zonula occludens toxin, and it was developed as an antagonist at that pathway rather than as an agonist. Alba Therapeutics took it into celiac disease (PMID: 17697209), and it was later developed by 9 Meters Biopharma under the code INN-202 (NCT03569007). It is not approved anywhere.
The target is the intestinal tight junction. In celiac disease, gluten peptides reach the lamina propria and trigger an immune response, and increased paracellular permeability is one route by which they get there. Larazotide acts locally in the gut lumen to keep tight junctions closed. Mechanistic work links it to redistribution and rearrangement of tight junction proteins and actin filaments, and more recently to inhibition of myosin light chain kinase, which reduces tension on actin filaments and lets the junction close (PMID: 33881350). Because it works in the lumen and is taken orally, it is not designed to reach the systemic circulation.
Animal work supports the barrier mechanism outside celiac disease. In interleukin 10 gene-deficient mice, treatment reduced small intestinal permeability and attenuated colitis, with lower colonic tumor necrosis factor alpha secretion at 17 weeks (PMID: 18829978). In pigs, it induced recovery of ischemia-injured jejunum through repair of tight junctions (PMID: 33886649). Rat studies report reduced intestinal permeability and bacterial translocation in acute pancreatitis (PMID: 38441784) and reduced liver and intestinal damage in acute liver failure (PMID: 34791921).
The human record is unusually complete for a compound sold as a research chemical, and it is mixed. A proof of concept study in celiac disease subjects challenged with gluten found no increase in adverse events, no rise in intestinal permeability in the treated group against a 70 percent rise on placebo, and fewer gastrointestinal symptoms (PMID: 17697209). Two gluten-challenge trials in 86 and 184 patients failed to separate from placebo on the lactulose to mannitol permeability ratio, but reported reductions in symptoms and, in the larger trial, lower anti-transglutaminase antibody rises (PMID: 22825365, PMID: 23163616). A 342-patient phase 2b trial in patients who still had symptoms on a gluten-free diet met its primary symptom endpoint at the lowest dose tested and not at higher doses (PMID: 25683116). The phase 3 trial then stopped: NCT03569007 enrolled 307 patients and was terminated in 2022 after a pre-specified interim analysis indicated that the number of additional patients needed to show a significant clinical effect was too large to continue (NCT03569007; sponsor announcement, June 2022).
Interest has since moved to other barrier-driven conditions. A phase 2a randomized trial in 12 children with multisystem inflammatory syndrome after COVID-19 reported no larazotide-related adverse events, faster clearance of circulating SARS-CoV-2 spike antigen and faster resolution of gastrointestinal symptoms (PMID: 40737433). A long COVID phase 2a trial has completed (NCT05747534). What is sold as a research chemical capsule is an investigational drug, not an approved medicine.
What forms does Larazotide (AT-1001) come in?
Larazotide (AT-1001) is available in capsule form.
How much does Larazotide (AT-1001) cost?
Prices start at $99.99 across 1 verified vendor.
How do I compare Larazotide (AT-1001) vendors?
Compare prices, payment methods, shipping, and COA scores across 1 vendor.
Research Tools
Related Compounds
View AllLL-37
Immune & InflammationPhase 2LL-37 is the only human cathelicidin, a 37-amino-acid amphipathic alpha-helical peptide ([LL-37, 37 aa]) cleaved from the C-terminus of the 170-amino-acid precursor hCAP-18 (human cationic antimicrobial protein, 18 kDa), which is encoded by the CAMP gene on chromosome 3p21.31.
Thymosin Alpha-1 (TA1)
Immune & InflammationFDA ApprovedThymosin alpha-1 (Tα1) is a 28-amino-acid N-acetylated peptide (N-Ac-Ser-Asp-Ala-Ala-Val-Asp-Thr-Ser-Ser-Glu-Ile-Thr-Thr-Lys-Asp-Leu-Lys-Glu-Lys-Lys-Glu-Val-Val-Glu-Glu-Ala-Glu-Asn) isolated and characterized by Allan Goldstein's laboratory at George Washington University in the 1970s as the immunologically active cleavage product of a larger precursor (prothymosin alpha) found in thymic tissue.
Free 2026 Peptide Cheat Sheet — 50 pages, PDF
Reconstitution math, concentration charts, half-lives, and vendor trust tiers. The reference we wish we had on day one.
