Skip to content

    Research Use Only

    This site is an educational resource for research compounds. We do not endorse human consumption of any compound. BodyHackGuide and BHG Labs share common ownership; we rank every vendor on the same public methodology, and we earn a commission on purchases through our links. By entering, you confirm you are 21 years of age or older and agree to our Terms & Privacy Policy.

    100K+ researchers trust BodyHackGuide — Join r/BodyHackGuide
    Larazotide (AT-1001) molecular structure

    Larazotide (AT-1001)

    Immune & InflammationPhase 3

    Also known as: Larazotide acetate, AT-1001, AT1001, AT-2347, INN-202

    Larazotide is an eight amino acid peptide with the sequence glycine-glycine-valine-leucine-valine-glutamine-proline-glycine, usually supplied as the acetate salt. Its structure derives from a protein secreted by Vibrio cholerae, the zonula occludens toxin, and it was developed as an antagonist at that pathway rather than as an agonist.

    Half-Life: Not established as a systemic value. Larazotide is designed to act locally in the intestinal lumen and is given orally rather than for systemic exposure (PMID: 33881350); single-dose safety, tolerance and pharmacokinetics were assessed in a phase 1b study in celiac disease subjects (PMID: 17697209)Route: OralMW: 725.85 g/mol (free peptide); 785.9 g/mol as the acetate saltCAS: 258818-34-7
    Last reviewed:
    Immune & Inflammation
    Category
    Phase 3
    Research Stage

    Overview

    Best Price Available

    Disguised Alpha logo

    Disguised Alpha

    $99.99

    60 capsules · capsule

    At A Glance

    Mechanism

    Larazotide is a tight junction regulator, described as a zonulin antagonist. Zonulin signaling opens the paracellular space between intestinal epithelial cells; larazotide acts in the gut lumen to block that opening and to promote reassembly of tight junctions, with redistributio

    Half-Life
    Not established as a systemic value. Larazotide is designed to act locally in the intestinal lumen and is given orally rather than for systemic exposure (PMID: 33881350); single-dose safety, tolerance and pharmacokinetics were assessed in a phase 1b study in celiac disease subjects (PMID: 17697209)
    Routes
    Oral
    Potential Benefits
    Prevented the gluten-induced rise in intestinal permeability seen on placebo and reduced gastrointestinal symptoms in adults with celiac disease in a phase 1b proof of concept study (PMID: 17697209)Reduced gluten-induced symptom severity and anti-transglutaminase antibody rises in adults with celiac disease undergoing gluten challenge in a 184-patient randomized trial (PMID: 23163616)Met the primary symptom endpoint at the lowest dose tested in 342 adults with celiac disease who still had symptoms on a gluten-free diet (PMID: 25683116)Reduced small intestinal permeability and attenuated colitis in interleukin 10 gene-deficient mice (PMID: 18829978)Promoted recovery of ischemia-injured jejunum through tight junction repair in pigs (PMID: 33886649)Faster clearance of circulating SARS-CoV-2 spike antigen and faster resolution of gastrointestinal symptoms in 12 children with multisystem inflammatory syndrome in a phase 2a trial (PMID: 40737433)

    Overview

    Larazotide is an eight amino acid peptide with the sequence glycine-glycine-valine-leucine-valine-glutamine-proline-glycine, usually supplied as the acetate salt. Its structure derives from a protein secreted by Vibrio cholerae, the zonula occludens toxin, and it was developed as an antagonist at that pathway rather than as an agonist. Alba Therapeutics took it into celiac disease (PMID: 17697209), and it was later developed by 9 Meters Biopharma under the code INN-202 (NCT03569007). It is not approved anywhere. The target is the intestinal tight junction. In celiac disease, gluten peptides reach the lamina propria and trigger an immune response, and increased paracellular permeability is one route by which they get there. Larazotide acts locally in the gut lumen to keep tight junctions closed. Mechanistic work links it to redistribution and rearrangement of tight junction proteins and actin filaments, and more recently to inhibition of myosin light chain kinase, which reduces tension on actin filaments and lets the junction close (PMID: 33881350). Because it works in the lumen and is taken orally, it is not designed to reach the systemic circulation. Animal work supports the barrier mechanism outside celiac disease. In interleukin 10 gene-deficient mice, treatment reduced small intestinal permeability and attenuated colitis, with lower colonic tumor necrosis factor alpha secretion at 17 weeks (PMID: 18829978). In pigs, it induced recovery of ischemia-injured jejunum through repair of tight junctions (PMID: 33886649). Rat studies report reduced intestinal permeability and bacterial translocation in acute pancreatitis (PMID: 38441784) and reduced liver and intestinal damage in acute liver failure (PMID: 34791921). The human record is unusually complete for a compound sold as a research chemical, and it is mixed. A proof of concept study in celiac disease subjects challenged with gluten found no increase in adverse events, no rise in intestinal permeability in the treated group against a 70 percent rise on placebo, and fewer gastrointestinal symptoms (PMID: 17697209). Two gluten-challenge trials in 86 and 184 patients failed to separate from placebo on the lactulose to mannitol permeability ratio, but reported reductions in symptoms and, in the larger trial, lower anti-transglutaminase antibody rises (PMID: 22825365, PMID: 23163616). A 342-patient phase 2b trial in patients who still had symptoms on a gluten-free diet met its primary symptom endpoint at the lowest dose tested and not at higher doses (PMID: 25683116). The phase 3 trial then stopped: NCT03569007 enrolled 307 patients and was terminated in 2022 after a pre-specified interim analysis indicated that the number of additional patients needed to show a significant clinical effect was too large to continue (NCT03569007; sponsor announcement, June 2022). Interest has since moved to other barrier-driven conditions. A phase 2a randomized trial in 12 children with multisystem inflammatory syndrome after COVID-19 reported no larazotide-related adverse events, faster clearance of circulating SARS-CoV-2 spike antigen and faster resolution of gastrointestinal symptoms (PMID: 40737433). A long COVID phase 2a trial has completed (NCT05747534). What is sold as a research chemical capsule is an investigational drug, not an approved medicine.

    Potential Research Fields

    Intestinal barrier functionCeliac diseaseTight junction pharmacologyPost-viral inflammatory syndromes

    Chemical Information

    IUPAC Name

    Not yet available

    CAS Number

    258818-34-7

    Molecular Formula

    C32H55N9O10

    Molecular Mass

    725.85 g/mol (free peptide)

    Dosing & Protocols

    Unlock Dosing Protocols

    Free account gets you:

    • View beginner, intermediate & advanced protocols
    • See weight-based dosing calculations
    • Access cycle length & frequency data

    2,800+ researchers already in

    Research

    Unlock Research Data

    Free account gets you:

    • Browse PubMed study summaries
    • See clinical trial phases & results
    • Access mechanism of action details

    2,800+ researchers already in

    Interactions

    Contraindications

    No pharmacological contraindications have been established in the published trials. Mechanism-based caution: larazotide does not treat celiac disease and does not make gluten safe to eat. In every trial, patients stayed on a gluten-free diet or were given a controlled gluten challenge under supervision, and the compound was studied as an addition to the diet, not a replacement for it (PMID: 25683116). Trial exclusion criteria in the phase 3 study covered refractory celiac disease, severe complications of celiac disease and chronic active gastrointestinal disease other than celiac disease (NCT03569007).

    Research Disclaimer

    This interaction data is compiled from published research and community reports. It may not be exhaustive. Always consult a healthcare professional before combining compounds.

    Best Price

    $99.99

    Best $/mg

    Vendors

    1

    Listings

    1

    capsule

    Form
    Sort
    Vendor Product Form Qty Price $/mg Coupon
    Disguised Alpha logo
    Disguised Alpha
    50
    🇺🇸US🇪🇺EU🇬🇧UK
    Larazotide capsules (60) capsule 60 capsules● In Stock $99.99BEST

    Get Larazotide (AT-1001) Price Drop Alerts

    Set a target price and we'll notify you when any vendor drops below it. Current lowest: $99.99

    Sign in to leave a review

    Reviews on BodyHackGuide are tied to verified user accounts and moderated before publishing. Sign in (free, no spam) to share your experience with Larazotide (AT-1001).

    Current low
    $99.99
    as of Sep 7, 2026
    7-day low
    $99.99
    30-day low
    $99.99
    30-day change
    baseline building

    Tracking since Sep 7, 2026 · 1 data point

    Vendors Selling Larazotide (AT-1001)

    How we score these vendors

    Every supplier above is graded 0–100 on COA verification, payment transparency, shipping, reviews, and active listings. Methodology published, no pay-to-rank.

    View Scorecard

    Related Compounds

    View All

    LL-37

    Immune & InflammationPhase 2

    LL-37 is the only human cathelicidin, a 37-amino-acid amphipathic alpha-helical peptide ([LL-37, 37 aa]) cleaved from the C-terminus of the 170-amino-acid precursor hCAP-18 (human cationic antimicrobial protein, 18 kDa), which is encoded by the CAMP gene on chromosome 3p21.31.

    t½ ~30 minutes (free peptide; rapidly cleared by proteolysis). Human pharmacokinetics of exogenous LL-37 are not well characterized.
    3029 studiesView Profile

    Thymosin Alpha-1 (TA1)

    Immune & InflammationFDA Approved

    Thymosin alpha-1 (Tα1) is a 28-amino-acid N-acetylated peptide (N-Ac-Ser-Asp-Ala-Ala-Val-Asp-Thr-Ser-Ser-Glu-Ile-Thr-Thr-Lys-Asp-Leu-Lys-Glu-Lys-Lys-Glu-Val-Val-Glu-Glu-Ala-Glu-Asn) isolated and characterized by Allan Goldstein's laboratory at George Washington University in the 1970s as the immunologically active cleavage product of a larger precursor (prothymosin alpha) found in thymic tissue.

    t½ ~2 hours 1,600 mcg (1.6 mg) per injection (standard clinical dose)
    701 studiesView Profile

    View Full Dosage Guide →

    Protocols, calculator & safety for Larazotide (AT-1001)

    Best Price

    Disguised Alpha logo

    Disguised Alpha

    $99.99

    1 vendors · 1 listings

    Research Score

    30

    0 PubMed studies

    Quality Indicators

    Data Completeness

    63%
    Description
    Mechanism of Action
    Chemical Data
    Dosing Protocols
    Safety Profile
    PubMed Studies
    Interactions
    Vendor Listings

    Quick Facts

    Half-Life

    Not established as a systemic value. Larazotide is designed to act locally in the intestinal lumen and is given orally rather than for systemic exposure (PMID: 33881350); single-dose safety, tolerance and pharmacokinetics were assessed in a phase 1b study in celiac disease subjects (PMID: 17697209)

    Molecular Weight

    725.85 g/mol (free peptide)

    Administration

    Oral

    CAS Number

    258818-34-7

    Trial Phase

    Phase 3

    0

    Research Disclaimer

    This information is for educational and research purposes only. Not intended as medical advice. Consult a healthcare professional before use.

    Frequently Asked Questions

    What is Larazotide (AT-1001) used for in research?

    Larazotide is an eight amino acid peptide with the sequence glycine-glycine-valine-leucine-valine-glutamine-proline-glycine, usually supplied as the acetate salt. Its structure derives from a protein secreted by Vibrio cholerae, the zonula occludens toxin, and it was developed as an antagonist at that pathway rather than as an agonist. Alba Therapeutics took it into celiac disease (PMID: 17697209), and it was later developed by 9 Meters Biopharma under the code INN-202 (NCT03569007). It is not approved anywhere.

    The target is the intestinal tight junction. In celiac disease, gluten peptides reach the lamina propria and trigger an immune response, and increased paracellular permeability is one route by which they get there. Larazotide acts locally in the gut lumen to keep tight junctions closed. Mechanistic work links it to redistribution and rearrangement of tight junction proteins and actin filaments, and more recently to inhibition of myosin light chain kinase, which reduces tension on actin filaments and lets the junction close (PMID: 33881350). Because it works in the lumen and is taken orally, it is not designed to reach the systemic circulation.

    Animal work supports the barrier mechanism outside celiac disease. In interleukin 10 gene-deficient mice, treatment reduced small intestinal permeability and attenuated colitis, with lower colonic tumor necrosis factor alpha secretion at 17 weeks (PMID: 18829978). In pigs, it induced recovery of ischemia-injured jejunum through repair of tight junctions (PMID: 33886649). Rat studies report reduced intestinal permeability and bacterial translocation in acute pancreatitis (PMID: 38441784) and reduced liver and intestinal damage in acute liver failure (PMID: 34791921).

    The human record is unusually complete for a compound sold as a research chemical, and it is mixed. A proof of concept study in celiac disease subjects challenged with gluten found no increase in adverse events, no rise in intestinal permeability in the treated group against a 70 percent rise on placebo, and fewer gastrointestinal symptoms (PMID: 17697209). Two gluten-challenge trials in 86 and 184 patients failed to separate from placebo on the lactulose to mannitol permeability ratio, but reported reductions in symptoms and, in the larger trial, lower anti-transglutaminase antibody rises (PMID: 22825365, PMID: 23163616). A 342-patient phase 2b trial in patients who still had symptoms on a gluten-free diet met its primary symptom endpoint at the lowest dose tested and not at higher doses (PMID: 25683116). The phase 3 trial then stopped: NCT03569007 enrolled 307 patients and was terminated in 2022 after a pre-specified interim analysis indicated that the number of additional patients needed to show a significant clinical effect was too large to continue (NCT03569007; sponsor announcement, June 2022).

    Interest has since moved to other barrier-driven conditions. A phase 2a randomized trial in 12 children with multisystem inflammatory syndrome after COVID-19 reported no larazotide-related adverse events, faster clearance of circulating SARS-CoV-2 spike antigen and faster resolution of gastrointestinal symptoms (PMID: 40737433). A long COVID phase 2a trial has completed (NCT05747534). What is sold as a research chemical capsule is an investigational drug, not an approved medicine.

    What forms does Larazotide (AT-1001) come in?

    Larazotide (AT-1001) is available in capsule form.

    How much does Larazotide (AT-1001) cost?

    Prices start at $99.99 across 1 verified vendor.

    How do I compare Larazotide (AT-1001) vendors?

    Compare prices, payment methods, shipping, and COA scores across 1 vendor.

    Research Tools

    Related Compounds

    View All

    LL-37

    Immune & InflammationPhase 2

    LL-37 is the only human cathelicidin, a 37-amino-acid amphipathic alpha-helical peptide ([LL-37, 37 aa]) cleaved from the C-terminus of the 170-amino-acid precursor hCAP-18 (human cationic antimicrobial protein, 18 kDa), which is encoded by the CAMP gene on chromosome 3p21.31.

    t½ ~30 minutes (free peptide; rapidly cleared by proteolysis). Human pharmacokinetics of exogenous LL-37 are not well characterized.
    3029 studiesView Profile

    Thymosin Alpha-1 (TA1)

    Immune & InflammationFDA Approved

    Thymosin alpha-1 (Tα1) is a 28-amino-acid N-acetylated peptide (N-Ac-Ser-Asp-Ala-Ala-Val-Asp-Thr-Ser-Ser-Glu-Ile-Thr-Thr-Lys-Asp-Leu-Lys-Glu-Lys-Lys-Glu-Val-Val-Glu-Glu-Ala-Glu-Asn) isolated and characterized by Allan Goldstein's laboratory at George Washington University in the 1970s as the immunologically active cleavage product of a larger precursor (prothymosin alpha) found in thymic tissue.

    t½ ~2 hours 1,600 mcg (1.6 mg) per injection (standard clinical dose)
    701 studiesView Profile

    Free 2026 Peptide Cheat Sheet — 50 pages, PDF

    Reconstitution math, concentration charts, half-lives, and vendor trust tiers. The reference we wish we had on day one.

    Download Free

    Need bloodwork before starting?

    Full hormone + metabolic panels from Anabolic Insights. Code CHONCH for first-order discount.