Skip to content

    Research Use Only

    This site is an independent educational resource for research compounds. We do not sell, distribute, or endorse human consumption of any compound. By entering, you confirm you are 21 years of age or older and agree to our Terms & Privacy Policy.

    100K+ researchers trust BodyHackGuide — Join r/BodyHackGuide

    LL-37 vs Thymosin Alpha-1 (TA1)

    Independent, side-by-side comparison of LL-37 and Thymosin Alpha-1 (TA1): mechanism, half-life, dose range, safety profile, and live vendor pricing. Updated continuously as new research and listings land.

    LL-37 from $45.00
    Thymosin Alpha-1 (TA1) from $39.99

    Live price snapshot

    LL-37

    Current low
    $45.00
    as of Apr 22, 2026
    7-day low
    no 7d data yet
    30-day low
    no 30d data yet
    30-day change
    baseline building

    Thymosin Alpha-1 (TA1)

    Current low
    $65.00
    as of Apr 22, 2026
    7-day low
    no 7d data yet
    30-day low
    no 30d data yet
    30-day change
    baseline building

    LL-37

    LL-37 is the only human cathelicidin, a 37-amino-acid amphipathic alpha-helical peptide ([LL-37, 37 aa]) cleaved from the C-terminus of the 170-amino-acid precursor hCAP-18 (human cationic…

    Live lowest price: $45.00 across 1 vendor

    Full LL-37 profile

    Thymosin Alpha-1 (TA1)

    Thymosin alpha-1 (Tα1) is a 28-amino-acid N-acetylated peptide (N-Ac-Ser-Asp-Ala-Ala-Val-Asp-Thr-Ser-Ser-Glu-Ile-Thr-Thr-Lys-Asp-Leu-Lys-Glu-Lys-Lys-Glu-Val-Val-Glu-Glu-Ala-Glu-Asn) isolated and characterized by Allan…

    Live lowest price: $39.99 across 3 vendors

    Full Thymosin Alpha-1 (TA1) profile

    Side-by-side comparison

    Attribute LL-37 Thymosin Alpha-1 (TA1)
    Category Immune & Inflammation Immune & Inflammation
    Research Stage Clinical Approved (International)
    Mechanism of Action LL-37's biological activity spans three functional categories: direct antimicrobial, immunomodulatory, and tissue-remodeling. Each operates through partially distinct mechanisms. Direct Antimicrobial Mechanism (Membrane Disruption): LL-37 is a cationic… Thymosin alpha-1 does not act through a single canonical receptor in the way many peptides do. Its mechanism is pleiotropic, involving pattern-recognition receptors, modulation of immune cell maturation and function, and shifts in cytokine signaling patterns.…
    Half-Life ~30 minutes (free peptide; rapidly cleared by proteolysis). Human pharmacokinetics of exogenous LL-37 are not well characterized. ~2 hours
    Typical Dose Range 1,600 mcg (1.6 mg) per injection (standard clinical dose)
    Dosing Frequency Twice weekly (subcutaneous) - the approved Zadaxin schedule; alternatively 900 mcg daily for intensive short-term courses
    Administration Subcutaneous
    Side Effects LL-37 has a less benign side-effect profile than many peptides covered in this guide, reflecting its mechanistic potency and narrow therapeutic window. Common (injection site): - Injection site irritation — more pronounced than with most peptides. Redness,… Tα1 has one of the most benign side-effect profiles in the peptide space, supported by 45+ years of clinical experience in approved indications. Most users experience no acute side effects beyond mild injection site discomfort. Common (5-15% of users): -…
    Molecular Weight 4493.4 g/mol 3108 Da
    Common Vial Sizes 5mg, 10mg

    Price History

    2 data points
    • VANDL Labs
    • Ion Peptide

    Price History

    3 data points
    • OF
    • VANDL Labs
    • Ion Peptide

    LL-37 — potential benefits

    • Broad-spectrum antimicrobial activity
    • Wound healing acceleration
    • Biofilm disruption
    • Immune system modulation
    • Anti-inflammatory effects
    • Gut barrier support

    Thymosin Alpha-1 (TA1) — potential benefits

    • Immune enhancement
    • Antiviral defense
    • Cancer adjuvant therapy
    • Autoimmune modulation
    • Vaccine potentiation

    Frequently asked

    What's the difference between LL-37 and Thymosin Alpha-1 (TA1)?

    LL-37 is a immune & inflammation that ll-37's biological activity spans three functional categories: direct antimicrobial, immunomodulatory, and tissue-remodeling. each operates through partially distinct mechanisms.…. Thymosin Alpha-1 (TA1) is a immune & inflammation that thymosin alpha-1 does not act through a single canonical receptor in the way many peptides do. its mechanism is pleiotropic, involving pattern-recognition receptors, modulation of…. The two differ in mechanism, half-life (~30 minutes (free peptide; rapidly cleared by proteolysis). Human pharmacokinetics of exogenous LL-37 are not well characterized. vs ~2 hours), and typical dose range.

    Which has the longer half-life, LL-37 or Thymosin Alpha-1 (TA1)?

    LL-37 has a half-life of ~30 minutes (free peptide; rapidly cleared by proteolysis). Human pharmacokinetics of exogenous LL-37 are not well characterized.. Thymosin Alpha-1 (TA1) has a half-life of ~2 hours. Longer half-lives generally mean less frequent dosing but slower on/off kinetics.

    Which is cheaper, LL-37 or Thymosin Alpha-1 (TA1)?

    Current lowest live price on BodyHackGuide: LL-37 from $45.00, Thymosin Alpha-1 (TA1) from $39.99. Prices are pulled from the vendor listings tracked on BHG and change frequently — see the compare tables on each compound page for the current set of offers.

    Can you stack LL-37 and Thymosin Alpha-1 (TA1)?

    Stacking depends on mechanism overlap, safety profile, and goals. LL-37 and Thymosin Alpha-1 (TA1) should only be stacked after reviewing each compound's individual protocol page, side effect profile, and any published interaction data. Use the BodyHackGuide stack builder for a structured review before combining research compounds.

    See current vendor prices

    Live listings from the vendors we track, refreshed continuously.

    LL-37 prices Thymosin Alpha-1 (TA1) prices Compare all compounds

    Before you buy LL-37 or Thymosin Alpha-1 (TA1)

    Check the vendor trust score. Every supplier we track is rated 0–100 on COA verification, payment transparency, shipping, reviews, and listings — methodology published, no pay-to-rank.

    View Vendor Scorecard

    Related comparisons

    Thymosin-Alpha-1 vs BPC-157LL-37 vs BPC-157TB-500 vs Thymosin-Alpha-1BPC-157 vs TB-500KPV vs BPC-157

    Research use only. BodyHackGuide is an independent research reference. The compounds discussed on this page are not approved by the FDA for human consumption and are sold strictly for laboratory research. Prices shown are pulled from vendor listings tracked on BHG and are subject to change. We earn an affiliate commission on some outbound clicks — this never affects the data or pricing shown. See editorial standards and affiliate disclosure.