Immune & Inflammation · live pricing
Where to Buy LL-37 — Cheapest Vendor in 2026
Live LL-37 pricing across every research peptide vendor we track, ranked by price per mg. Updated daily. Right now the cheapest source is Ion Peptide at $9.00/mg.
LL-37 vendor ranking — cheapest first
Research profile
Mechanism, dosing, half-life, peer-reviewed studies for LL-37.
Coupon codes
Every active vendor coupon for LL-37, click-to-copy.
Reconstitution calculator
Vial size + BAC water → concentration, syringe units, doses per vial.
What is LL-37?
LL-37 is the only human cathelicidin, a 37-amino-acid amphipathic alpha-helical peptide ([LL-37, 37 aa]) cleaved from the C-terminus of the 170-amino-acid precursor hCAP-18 (human cationic antimicrobial protein, 18 kDa), which is encoded by the CAMP gene on chromosome 3p21.31. The "LL" in its name refers to the two leucine residues at the N-terminus; "37" is the length. LL-3… Read the full LL-37 research profile
Buying LL-37 — FAQ
Where can I buy LL-37 online?
LL-37 is available from 2 verified research peptide vendors tracked on BodyHackGuide. The cheapest current price per mg is Ion Peptide at $9.00/mg. Tap any "Buy" button on this page to go directly to the vendor's product page.
What's the cheapest price for LL-37?
Right now the lowest price per mg comes from Ion Peptide at $9.00/mg ($45.00 for 5mg). Daily price snapshots keep this ranking current — bookmark for the live cheapest source.
Is buying LL-37 online safe?
Vendor safety varies. BodyHackGuide ranks every vendor on a 0-100 Trust Score (COA verification, payment transparency, community feedback, shipping practices). Vendors below the Trust Score threshold aren't surfaced on this page. The vendor profile linked from each listing shows their full score breakdown.
Do I need a prescription for LL-37?
LL-37 is sold for research-use-only by the vendors on this page — no prescription required for research purchases. None of these vendors sell LL-37 for human consumption, and BodyHackGuide doesn't promote off-label use. Always consult a licensed practitioner before any compound enters a clinical context.
Affiliate disclosure. BodyHackGuide may earn a commission from purchases made via the links on this page — at no additional cost to you. Vendor rankings are based purely on live price-per-mg data and the published Trust Score rubric. We don't accept payment for editorial placement. See our full affiliate disclosure .
Free 2026 Peptide Cheat Sheet — 50 pages, PDF
Reconstitution math, concentration charts, half-lives, and vendor trust tiers. The reference we wish we had on day one.