Immune & Inflammation · price comparison
Where to Buy LL-37: Cheapest Vendor in 2026
LL-37 pricing across every research peptide vendor we track, ranked by price per mg. Prices change often, so check the vendor before you buy. The cheapest source we track is Ion Peptide at $9.00/mg.
LL-37 vendor ranking: cheapest first
Research profile
Mechanism, dosing, half-life, peer-reviewed studies for LL-37.
Coupon codes
Every active vendor coupon for LL-37, click-to-copy.
Reconstitution calculator
Vial size + BAC water → concentration, syringe units, doses per vial.
You may also like
What is LL-37?
LL-37 is the only human cathelicidin, a 37-amino-acid amphipathic alpha-helical peptide ([LL-37, 37 aa]) cleaved from the C-terminus of the 170-amino-acid precursor hCAP-18 (human cationic antimicrobial protein, 18 kDa), which is encoded by the CAMP gene on chromosome 3p21.31. The "LL" in its name refers to the two leucine residues at the N-terminus; "37" is the length. LL-… Read the full LL-37 research profile
Buying LL-37: FAQ
Where can I buy LL-37 online?
LL-37 has 2 in-stock listings from research peptide vendors tracked on BodyHackGuide. The cheapest current price per mg is Ion Peptide at $9.00/mg. Tap any "Buy" button on this page to go directly to the vendor's product page.
What's the cheapest price for LL-37?
The lowest price per mg we track comes from Ion Peptide at $9.00/mg ($45.00 for 5mg). Prices change often, so check the vendor before you buy.
Is buying LL-37 online safe?
Vendor safety varies. BodyHackGuide scores every vendor on a 0-100 Trust Score (COA verification, payment transparency, community feedback, shipping practices). This page ranks listings by price per mg, not by score, so check each vendor's score breakdown on its BodyHackGuide profile before you buy.
Do I need a prescription for LL-37?
LL-37 is sold for research-use-only by the vendors on this page; no prescription required for research purchases. None of these vendors sell LL-37 for human consumption, and BodyHackGuide doesn't promote off-label use. Always consult a licensed practitioner before any compound enters a clinical context.
Affiliate disclosure. BodyHackGuide earns a commission on some of its links, at no additional cost to you. Vendor rankings are based on price per mg from the listings we track. We don't accept payment for editorial placement. See our full affiliate disclosure .
Free 2026 Peptide Cheat Sheet (PDF)
38 compounds and blends: vial sizes, BAC water volumes, dosing ranges and bloodwork markers.