Best Peptides for Recovery & Healing (2026)

BPC-157 (Body Protection Compound-157) is a synthetic pentadecapeptide consisting of 15 amino acids (Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val) derived from a partial sequence of human gastric juice protein BPC. It has a molecular weight of 1419.53 Da and a CAS…

TB-500 is the name the market and the FDA use for a short synthetic fragment of thymosin beta-4: the seven-amino-acid, N-acetylated actin-binding sequence Ac-LKKTETQ (residues 17 to 23). Thymosin beta-4 itself is a 43-amino-acid peptide (about 4963 Da acetylated) and one of the…

Combined healing peptide blend

GHK-Cu is the copper(II) complex of the tripeptide glycyl-L-histidyl-L-lysine, a molecule Pickart and Thaler first pulled out of human plasma in 1973. The free peptide (GHK, C14H24N6O4) weighs about 340.4 Da; bind it 1:1 to copper and you get the neutral GHK-Cu complex (C14H22Cu…

KPV is a three-amino-acid peptide — Lysine-Proline-Valine — that makes up the C-terminal tail of alpha-MSH (alpha-melanocyte-stimulating hormone). With a molecular weight of only 342.4 Da, it is one of the smallest peptides in the research space, yet it preserves much of the ant…

PDRN (Polydeoxyribonucleotide) is a biotechnological compound derived from salmon sperm DNA (Oncorhynchus mykiss) through extraction, purification, and fractionation. It consists of polynucleotide chains with molecular weights ranging from 50 to 1500 kDa. PDRN is widely used in…

Thymosin alpha-1 (Tα1) is a 28-amino-acid N-acetylated peptide (N-Ac-Ser-Asp-Ala-Ala-Val-Asp-Thr-Ser-Ser-Glu-Ile-Thr-Thr-Lys-Asp-Leu-Lys-Glu-Lys-Lys-Glu-Val-Val-Glu-Glu-Ala-Glu-Asn) isolated and characterized by Allan Goldstein's laboratory at George Washington University in the…

Thymalin is a thymus-derived peptide complex developed in the 1970s by Vladimir Khavinson and the Leningrad (now St. Petersburg) Institute of Bioregulation and Gerontology as part of a broader program to identify tissue-specific regulatory peptides from mammalian organs. Produce…

Thymogen (also transliterated Timogen or ╨ó╨╕╨╝╨╛╨│╨╡╨╜) is a synthetic dipeptide — glutamyl-tryptophan (Glu-Trp, or EW) — developed by the St Petersburg Institute of Bioregulation and Gerontology under Professor Vladimir Khavinson. Thymogen belongs to the same family of Russian…

LL-37 is the only human cathelicidin, a 37-amino-acid amphipathic alpha-helical peptide ([LL-37, 37 aa]) cleaved from the C-terminus of the 170-amino-acid precursor hCAP-18 (human cationic antimicrobial protein, 18 kDa), which is encoded by the CAMP gene o…

Humanin is a 24-amino-acid peptide (MAPRGFSCLLLLTSEIDLPVKRRA) encoded within the mitochondrial 16S ribosomal RNA gene and translated from a short open reading frame that was not recognized as biologically active until 2001, when Hashimoto and colleagues identified it in a screen…

ARA-290, also known as Cibinetide or pHBSP (Helix B Surface Peptide), is an 11-amino-acid peptide — QEQLERALNSS — designed to mimic a specific region of the tissue-protective surface of erythropoietin (EPO) without activating the classical hematopoietic EPO receptor that drives…

IGF-1 LR3 (Long R3 IGF-1) is a synthetic analog of human insulin-like growth factor 1 modified at two positions to dramatically extend its serum half-life and amplify its tissue bioactivity compared to native IGF-1. The "LR3" designation describes the two key modifications: "L"…

PEG-MGF (Pegylated Mechano Growth Factor) is a synthetic, PEGylated form of Mechano Growth Factor (MGF) — an alternatively spliced variant of IGF-1 produced locally in muscle and other tissues in response to mechanical loading or damage. MGF differs from systemic IGF-1 in that i…

Cartalax is a short synthetic peptide developed in Russia by Vladimir Khavinson and colleagues at the St. Petersburg Institute of Bioregulation and Gerontology, positioned as a "cartilage bioregulator" intended to support chondrocyte function, cartilage matrix synthesis, and joi…

Pinealon is a synthetic tripeptide — glutamyl-aspartyl-arginine (Glu-Asp-Arg, or EDR) — developed by the St Petersburg Institute of Bioregulation and Gerontology (IBG) under the leadership of Professor Vladimir Khavinson, the dominant figure in what is collectively known as the…

Livagen is a short synthetic peptide developed in Russia by Vladimir Khavinson and his collaborators at the St. Petersburg Institute of Bioregulation and Gerontology, positioned as a "liver bioregulator" intended to normalise age-related and stress-related changes in hepatic tis…

Cordyceps is a genus of parasitic fungi (order Hypocreales, family Cordycipitaceae) historically prized in traditional Tibetan, Chinese, and Bhutanese medicine for their purported abilities to restore vitality, improve athletic performance, support respiratory and kidney functio…