Skip to content
    Compare notes on r/BodyHackGuideCompare notes with other researchers. Join r/BodyHackGuide
    LL-37 molecular structure

    LL-37

    Immune & InflammationPhase 2

    LL-37 is the only human cathelicidin, a 37-amino-acid amphipathic alpha-helical peptide ([LL-37, 37 aa]) cleaved from the C-terminus of the 170-amino-acid precursor hCAP-18 (human cationic antimicrobial protein, 18 kDa), which is encoded by the CAMP gene on chromosome 3p21.31. The "LL" in its name refers to the two leucine residues at the N-terminus; "37" is the length.

    Disguised Alpha logo

    Featured vendor

    $10.00/mg$49.99 for 5mg

    at Disguised Alpha ·

    Half-life: ~30 minutes (free peptideMW: 4493.4 g/molCAS: 154947-66-73,029 PubMed results
    Last reviewed:

    Overview

    At A Glance

    Mechanism

    LL-37's biological activity spans three functional categories: direct antimicrobial, immunomodulatory, and tissue-remodeling. Each operates through partially distinct mechanisms.…

    Half-Life
    ~30 minutes (free peptide; rapidly cleared by proteolysis). Human pharmacokinetics of exogenous LL-37 are not well characterized.
    Potential Benefits
    Broad-spectrum antimicrobial activityWound healing accelerationBiofilm disruptionImmune system modulationAnti-inflammatory effectsGut barrier support
    Safety Notes
    Common
    Injection site pain and inflammationTransient fever (immune activation)Nausea

    Mechanism of Action

    LL-37's biological activity spans three functional categories: direct antimicrobial, immunomodulatory, and tissue-remodeling. Each operates through partially distinct mechanisms.

    Direct Antimicrobial Mechanism (Membrane Disruption):

    LL-37 is a cationic amphipathic alpha-helical peptide. In aqueous solution it exists as an unstructured random coil; upon contact with negatively charged target membranes (like bacterial outer and inner membranes), it folds into its characteristic alpha-helix and inserts into the lipid bilayer. Multiple mechanistic models describe the subsequent membrane disruption:

    • Carpet model: LL-37 molecules accumulate parallel to the membrane surface ("carpet"), eventually destabilizing the entire lipid organization and causing membrane breakdown
    • Toroidal pore model: LL-37 inserts perpendicular to the membrane, bringing lipid head groups with it and forming transmembrane pores that release contents and dissipate membrane potential
    • Barrel-stave model: LL-37 forms multimeric transmembrane channels (less characterized for LL-37 specifically)

    The practical result is rapid (minutes) membrane permeabilization and killing of susceptible organisms. Minimum inhibitory concentrations (MICs) range from 1-20 uM for many bacterial species in standardized assays, but MIC values are notably environment-dependent - LL-37 activity is dramatically reduced by physiological salt concentrations, certain serum components (albumin, lipopolysaccharide-binding protein), and host tissue secretions. This environmental sensitivity is a major translational challenge: what works powerfully in culture may have much weaker in vivo activity.

    Target Specificity:

    LL-37's preference for bacterial over mammalian membranes reflects:

    • Bacterial membranes are rich in negatively charged lipids (phosphatidylglycerol, cardiolipin in bacteria vs phosphatidylcholine in mammals)
    • Bacterial membranes lack cholesterol (which rigidifies mammalian membranes and reduces peptide insertion)
    • Bacterial outer surfaces (LPS in gram-negatives, teichoic acids in gram-positives) bind cationic peptides
    • Membrane potential differences favor peptide accumulation at bacterial membranes

    However, this specificity is not absolute. At sufficient concentrations, LL-37 can damage mammalian cells - particularly those with altered membrane composition (cancer cells, apoptotic cells). This narrow therapeutic window is a primary reason systemic LL-37 development has been challenging.

    Antiviral Activity:

    LL-37 can inactivate enveloped viruses by disrupting viral envelope integrity. Documented activity against:

    • Influenza A and B
    • HIV (modestly)
    • Vaccinia
    • Herpes simplex
    • Respiratory syncytial virus (RSV)
    • SARS-CoV-2 (in vitro; clinical relevance uncertain)

    Non-enveloped viruses are generally less susceptible because they lack the lipid envelope that LL-37 targets.

    Antifungal Activity:

    Active against Candida species and some filamentous fungi. Similar membrane-disruption mechanism.

    Anti-Biofilm Activity:

    LL-37 has documented activity against biofilm-embedded organisms, which is clinically relevant because conventional antibiotics often fail against biofilm infections. Mechanisms include disruption of quorum sensing, reduction of adhesion, and direct killing within biofilms.

    Immunomodulatory Mechanisms (FPR2/ALX, P2X7, TLR):

    LL-37 signals through multiple receptors on immune cells:

    • FPR2/ALX (formyl peptide receptor 2): primary receptor for LL-37 chemotactic effects on neutrophils, monocytes, T cells, and mast cells
    • P2X7 receptor: mediates some inflammatory effects and inflammasome activation
    • EGFR (epidermal growth factor receptor): transactivation pathway contributing to wound healing
    • TLR9 (intracellular): when LL-37 is complexed with self-DNA; relevant for psoriasis pathogenesis and certain antiviral responses

    Downstream effects:

    • Leukocyte chemotaxis
    • Modulation of cytokine production (context-dependent; can both increase and decrease specific cytokines)
    • Neutralization of LPS (reduces endotoxin-driven inflammation)
    • Promotion of Th17 differentiation in certain contexts (relevant for psoriasis pathology)
    • Activation of plasmacytoid dendritic cells (context-dependent - protective for acute infection, pathogenic in psoriasis)

    Wound Healing Mechanisms:

    LL-37 promotes wound repair through:

    • Stimulation of keratinocyte migration and proliferation (re-epithelialization)
    • Angiogenesis (via FPR2/ALX and EGFR transactivation; stimulation of VEGF production)
    • Modulation of local immune response in wound bed
    • Direct antimicrobial protection of wound surface

    Pharmacokinetics:

    • Endogenous LL-37 plasma concentrations: typically ~1-2 ug/mL (as hCAP18/LL-37) in healthy adults; vary with infection status, vitamin D status, and circadian rhythm
    • Exogenous LL-37 administered subcutaneously: human pharmacokinetic data are sparse and not well characterized. The free peptide is cleared rapidly by proteolysis (effective circulating half-life on the order of ~30 minutes), while protein-bound hCAP18/LL-37 is more stable. Precise absorption and elimination parameters for injected LL-37 have not been established in controlled human studies
    • Protein binding to serum albumin and other plasma proteins reduces free active concentration
    • Cleared primarily through proteolytic degradation in tissues
    • Tissue distribution favors mucosal surfaces and skin where endogenous production is highest

    Vitamin D Connection:

    The CAMP gene (encoding LL-37) has a vitamin D response element in its promoter. 1,25-dihydroxyvitamin D (calcitriol) upregulates LL-37 production substantially. This is one mechanism by which vitamin D supports immune function against tuberculosis and other infections. Vitamin D deficiency reduces endogenous LL-37 and may predispose to certain infections. This is also why vitamin D sufficiency (25-OH-D > 30-40 ng/mL) is considered baseline immune tuning - it supports endogenous LL-37 production without requiring exogenous peptide administration.

    Overview

    LL-37 is the only human cathelicidin, a 37-amino-acid amphipathic alpha-helical peptide ([LL-37, 37 aa]) cleaved from the C-terminus of the 170-amino-acid precursor hCAP-18 (human cationic antimicrobial protein, 18 kDa), which is encoded by the CAMP gene on chromosome 3p21.31. The "LL" in its name refers to the two leucine residues at the N-terminus; "37" is the length. LL-37 is stored in the secondary granules of neutrophils and produced by mucosal epithelial cells, keratinocytes, sebocytes, and certain lymphocyte populations, where it serves as a core component of the innate immune system — one of the evolutionarily ancient defenses that operates without requiring prior antigen exposure or adaptive immune priming. The peptide was first isolated in 1995 by Jürgen Gudmundsson, Birgitta Agerberth, and colleagues at the Karolinska Institute, and has since been the subject of more than 5,000 published studies exploring its roles in infection defense, wound healing, inflammation modulation, angiogenesis, and (paradoxically) inflammatory disease pathogenesis ([Gudmundsson et al., 1996], [Vandamme et al., 2012]).

    LL-37's mechanism of antimicrobial action is fundamentally different from conventional antibiotics. Where small-molecule antibiotics target specific bacterial enzymes or structures (ribosomes, cell wall synthesis, DNA gyrase), LL-37 operates by direct physical disruption of microbial membranes. The peptide is cationic (net charge +6) and amphipathic — one face of the alpha-helix is hydrophobic, the other hydrophilic — which allows it to insert into negatively charged bacterial membranes (rich in phosphatidylglycerol and cardiolipin) while largely sparing mammalian cell membranes (rich in zwitterionic phosphatidylcholine and cholesterol). Once inserted, LL-37 forms transient pores, disrupts membrane potential, and kills the target organism. This mechanism is active against a broad spectrum — gram-positive and gram-negative bacteria, mycobacteria (including M. tuberculosis), fungi (Candida species), some enveloped viruses, and even biofilm-embedded organisms that resist conventional antibiotics ([Dürr et al., 2006]). Crucially, the membrane-disruption mechanism makes resistance development slower and more difficult than with molecular-target antibiotics — bacteria cannot easily redesign the bulk charge and composition of their membranes without compromising viability.

    Beyond direct antimicrobial effects, LL-37 has important immunomodulatory roles. It recruits neutrophils, monocytes, T cells, and mast cells to sites of infection; modulates cytokine production by immune cells; promotes wound re-epithelialization and angiogenesis; and interacts with pattern-recognition receptors (TLR, FPR2/ALX, P2X7) to shape innate immune responses. This immunomodulation is largely protective, but LL-37 has also been implicated in the pathogenesis of certain chronic inflammatory conditions — most notably rosacea (where cathelicidin processing is dysregulated leading to pathological LL-37 fragments) and psoriasis (where LL-37 complexed with self-DNA activates plasmacytoid dendritic cells via TLR9, driving the Th17 inflammatory cascade characteristic of the disease). This dual role — protective in acute infection, pathogenic when dysregulated in chronic inflammatory disease — is a recurring theme in cathelicidin biology ([Yamasaki et al., 2007], [Lande et al., 2007]).

    In clinical use, LL-37 has been investigated as a topical treatment for chronic infected wounds and diabetic foot ulcers (with some positive results in early trials but no approved product), as an adjunct to eradicate biofilm-related infections, and — more controversially in peptide-user communities — as a subcutaneous injection for systemic antimicrobial activity in chronic Lyme disease, chronic infections, and immune dysregulation syndromes. The peptide-community use is not supported by rigorous trial evidence, and the theoretical concerns are significant: systemic LL-37 at therapeutic antimicrobial concentrations has narrow margins between pharmacologic and toxic effects because the same membrane-disrupting activity that kills bacteria can also damage mammalian membranes at sufficient concentrations. LL-37 also has pro-inflammatory potential at certain doses and in certain disease contexts. This entry covers the established biology of LL-37, the legitimate research interest, and the considerable uncertainty around off-label human use ([Hilchie et al., 2013]).

    LL-37 is frequently discussed alongside other peptides with overlapping or complementary roles. Cross-references include Thymosin-Alpha-1 for adaptive immune modulation, BPC-157 for tissue repair and vascular protection, and TB-500 for wound healing and actin biology. Unlike Tα1 which modulates host immunity to fight infection, LL-37 has direct antimicrobial activity — the two can be complementary in chronic infection contexts.

    Potential Research Fields

    Chronic infectionsWound healingCystic fibrosisChronic sinusitisSkin conditionsCancer

    Chemical Information

    IUPAC Name

    Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys... (37 amino acid sequence)

    CAS Number

    154947-66-7

    Molecular Formula

    C205H340N60O53S

    Molecular Mass

    4493.4 g/mol

    Amino Acid Sequence

    [LL-37, 37 aa]

    Dosing & Protocols

    Unlock the dosing protocols

    Enter your email to keep reading. It is free, and it opens these tabs on every compound page in this browser.

    • Dose, route, how often and how long
    • A titration schedule
    • Beginner, intermediate and advanced protocols
    • Reconstitution and handling notes

    You also get the free peptide cheat sheet by email. Unsubscribe anytime.

    Have an account? Sign in

    Research

    Unlock the research summary

    Enter your email to keep reading. It is free, and it opens these tabs on every compound page in this browser.

    • A summary of the key research
    • Safety and side effects
    • A link to the PubMed results

    You also get the free peptide cheat sheet by email. Unsubscribe anytime.

    Have an account? Sign in

    Interactions

    Interaction Matrix

    Contraindications

    Absolute contraindications:

    • Active psoriasis or psoriatic arthritis
    • Active rosacea
    • Active systemic lupus erythematosus
    • Active severe autoimmune dermatosis
    • Known hypersensitivity to LL-37 or cathelicidin preparations
    • Pregnancy
    • Breastfeeding
    • Severe mast cell activation syndrome
    • Active malignancy without oncology supervision

    Strong relative contraindications:

    • Personal history of psoriasis or rosacea (risk of flare or new-onset disease)
    • Strong family history of psoriasis
    • Moderate-to-severe renal impairment
    • History of severe drug or peptide allergy
    • Concurrent immunosuppressive therapy for autoimmunity (discuss with prescriber)
    • Chronic systemic inflammatory conditions not well controlled
    • Age < 18

    Drug interactions:

    • Psoriasis biologics (anti-IL-17, anti-IL-23, anti-TNF) or systemic methotrexate for psoriasis: Pharmacologically opposed — adding LL-37 in a psoriasis patient is counterproductive
    • Systemic corticosteroids at high dose: May neutralize LL-37 effects
    • Cyclosporine, tacrolimus: Complex interactions; discuss with specialist
    • Certain antibiotics with known LL-37 synergy: may produce potentiated effects (usually beneficial but monitor for adverse events)
    • Drugs with narrow therapeutic index that are highly protein-bound: LL-37 can compete for binding; monitor carefully
    • Other antimicrobial peptides (other cathelicidins, defensins): uncharacterized combinations

    Stop using if:

    • New appearance of red scaly plaques characteristic of psoriasis
    • New or worsened rosacea-like facial erythema
    • New signs of autoimmune skin disease
    • Persistent severe injection site reactions
    • Signs of allergic reaction (hives, facial swelling, breathing difficulty)
    • Unexplained elevation in creatinine or BUN
    • Any concerning persistent systemic symptoms
    • Pregnancy (confirmed or suspected)
    • New cancer diagnosis

    Monitoring:

    • Baseline: CBC with differential, complete metabolic panel (particularly creatinine, BUN), CRP, vitamin D, relevant infection markers
    • During therapy (4-6 weeks): repeat CBC, metabolic panel, inflammatory markers
    • For longer protocols: quarterly labs; annual if continued
    • Skin exam: at baseline, at 4-6 weeks, and whenever new skin symptoms arise
    • Individual awareness: patient/user should know to watch for specific warning signs (new plaque-like redness, facial inflammation, severe injection reactions)

    Specific Situations Requiring Caution:

    • Users with unexplained skin rashes or conditions should have dermatology evaluation before starting LL-37
    • Users with chronic infection diagnoses should ensure the diagnosis is well-established rather than assumed; some chronic illnesses mimicking "chronic Lyme" or "mold illness" have other etiologies that LL-37 cannot help
    • Users on complex polypharmacy should review medication list with clinician for interaction potential
    • Users with known renal disease should have baseline and follow-up creatinine before extended protocols

    What Is Generally Safe About LL-37 (To Avoid Over-Warning):

    • Short-term use in appropriate populations with clear indication has reasonable safety
    • Topical use on wounds has been extensively tested with good tolerability
    • Use alongside conventional infection therapy is commonly done without incident
    • Many users benefit without significant adverse events — the warnings above target specific at-risk populations

    Medical Supervision:

    LL-37 benefits significantly from integrative clinician supervision because:

    1. Appropriate indication selection is essential (and non-obvious for off-label use)
    2. Side-effect monitoring (particularly for inflammatory skin conditions) benefits from clinical assessment
    3. Complex chronic illness protocols using LL-37 are multi-component and individualized

    Solo LL-37 use for complex chronic illness is not recommended. Users should work with Lyme-literate, functional medicine, or integrative medicine clinicians.

    Research Disclaimer

    This interaction data is compiled from published research and community reports. It may not be exhaustive. Always consult a healthcare professional before combining compounds.

    Best Price

    $45.00

    up to $49.99

    Best $/mg

    $9.0000

    Vendors

    2

    Listings

    2

    vial

    Form
    Sort
    Vendor Product Form Qty Price $/mg Coupon
    Disguised Alpha logo
    Disguised Alpha
    50
    🇺🇸US🇪🇺EU🇬🇧UK
    LL-37 5 mg vial 1 vial● In Stock $49.99 $10.00 —
    Ion Peptide logo
    Ion Peptide
    70
    🇺🇸US🌍International
    LL-37 5mg vial 1 vial● In Stock $45.00BEST $9.00 —

    Sign in to leave a review

    Reviews on BodyHackGuide are tied to verified user accounts and moderated before publishing. Sign in (free, no spam) to share your experience with LL-37.

    Current low
    $45.00
    current listings
    7-day low
    —
    not enough history yet
    30-day low
    —
    not enough history yet
    30-day change
    —
    not enough history yet

    Tracking since Apr 22, 2026 · 2 data points

    Price History

    2 data points

    Vendors Selling LL-37

    How we score these vendors

    Every supplier above is graded 0 to 100 on COA verification, payment transparency, shipping, reviews, and active listings. Methodology published, no pay-to-rank.

    View Scorecard

    Related Compounds

    View All

    Larazotide (AT-1001)

    Immune & InflammationPhase 3

    Larazotide is an eight amino acid peptide with the sequence glycine-glycine-valine-leucine-valine-glutamine-proline-glycine, usually supplied as the acetate salt.

    t½ Not established as a systemic value. Larazotide is designed to act locally in the intestinal lumen and is given orally rather than for systemic exposure (PMID: 33881350); single-dose safety, tolerance and pharmacokinetics were assessed in a phase 1b study in celiac disease subjects (PMID: 17697209)
    PreclinicalView Profile

    Thymosin Alpha-1 (TA1)

    Immune & InflammationFDA Approved

    Thymosin alpha-1 (Tα1) is a 28-amino-acid N-acetylated peptide (N-Ac-Ser-Asp-Ala-Ala-Val-Asp-Thr-Ser-Ser-Glu-Ile-Thr-Thr-Lys-Asp-Leu-Lys-Glu-Lys-Lys-Glu-Val-Val-Glu-Glu-Ala-Glu-Asn) isolated and characterized by Allan Goldstein's laboratory at George Washington University in the 1970s as the immunologically active cleavage product of a larger precursor (prothymosin alpha) found in thymic tissue.

    t½ ~2 hours 1,600 mcg (1.6 mg) per injection (standard clinical dose)
    701 PubMedView Profile

    View Full Dosage Guide →

    Protocols, calculator & safety for LL-37

    Related Articles

    All Posts

    Gut Healing Supplements & Peptides: What the Research Actually Supports (2026)

    Most "gut healing" supplements and peptides are sold on animal studies and mechanism, not human results. The interventions with real human trial data are unglamorous and cheap: zinc-L-carnosine for the stomach lining, L-glutamine for a measured leaky gut, strain-specific probiotics, enteric-coated peppermint oil and the low-FODMAP diet for IBS, and soluble fiber done right. The hyped peptides (BPC-157, KPV) are almost entirely rat-and-petri-dish so far. And if your "stomach problem" is unexplained low iron or B12, the real issue might be too little stomach acid, which no supplement aisle fixes.

    7/7/2026

    The Complete Peptide Reconstitution Guide (2026): Ratios, Math, and Common Mistakes

    The master reconstitution reference for 17 peptides. BAC vs SWFI vs acetic acid, mg/mL targets, IU math on U100 syringes, storage and stability by peptide class, sterile technique, and the mistakes that destroy $60 vials. Includes worked examples for BPC-157, TB-500, GHK-Cu, semaglutide, tirzepatide, CJC-1295, ipamorelin, sermorelin, GHRPs, Melanotan II, PT-141, oxytocin, Semax, Selank, DSIP, and epithalon.

    4/21/2026

    Featured Price

    Disguised Alpha logo

    Disguised Alpha

    $49.99($10.00/mg)

    2 vendors · 2 listings

    Research Score

    100

    3,029 PubMed results

    Quality Indicators

    Data Completeness

    100%
    Description
    Mechanism of Action
    Chemical Data
    Dosing Protocols
    Safety Profile
    PubMed Results
    Interactions
    Vendor Listings

    Research Volume

    3,029PubMed results

    Well-researched compound

    Quick Facts

    Half-Life

    ~30 minutes (free peptide; rapidly cleared by proteolysis). Human pharmacokinetics of exogenous LL-37 are not well characterized.

    Molecular Weight

    4493.4 g/mol

    CAS Number

    154947-66-7

    Trial Phase

    Phase 2

    Safety Profile

    Moderate Risk

    Common Side Effects

    • • Injection site pain and inflammation
    • • Transient fever (immune activation)
    • • Nausea

    Stop Use If

    • Sepsis or uncontrolled systemic infection
    • Autoimmune conditions — may exacerbate

    Research Disclaimer

    This information is for educational and research purposes only. Not intended as medical advice. Consult a healthcare professional before use.

    Frequently Asked Questions

    What makes LL-37 different from regular antibiotics?

    LL-37 kills microbes by physically disrupting their membranes rather than targeting specific enzymes or structures like conventional antibiotics do. This gives it a broader spectrum (gram-positive, gram-negative, fungi, some viruses, biofilm-embedded organisms) and makes resistance harder to develop — bacteria can't easily redesign the bulk charge of their membranes without compromising viability. However, this potency comes with trade-offs: LL-37 has a narrower therapeutic window than many antibiotics, is sensitive to protein binding and salt concentrations in vivo, and has immunomodulatory effects that can be beneficial or harmful depending on context. It's a complementary tool rather than a replacement for conventional antibiotics.

    Can LL-37 cause psoriasis or make existing psoriasis worse?

    Yes, this is a genuine concern. LL-37 is involved in psoriasis pathogenesis — when complexed with self-DNA, it activates plasmacytoid dendritic cells via TLR9 and drives the Th17 inflammatory cascade characteristic of psoriasis. This is not theoretical; it's established disease mechanism. Users with active psoriasis should NOT use LL-37. Users with a personal or family history of psoriasis should exercise significant caution. Any new appearance of psoriasis-like plaques during LL-37 use warrants immediate discontinuation and dermatology evaluation. This same concern applies to rosacea to a lesser degree — dysregulated cathelicidin processing drives rosacea inflammation.

    Should I optimize vitamin D before using LL-37?

    Yes, this is the single most important preparatory step. The CAMP gene (encoding LL-37) is directly upregulated by vitamin D through a vitamin D response element in its promoter. Sufficient vitamin D (25-OH-D > 40 ng/mL) substantially boosts endogenous LL-37 production — sometimes enough that exogenous peptide is unnecessary. Vitamin D deficiency is a leading cause of cathelicidin insufficiency and the most common remediable cause. Optimizing vitamin D first (requires 4-8 weeks typically) is less expensive, better supported by evidence, and may resolve the underlying issue without exogenous peptide use. If endogenous LL-37 production is adequate after vitamin D optimization, many users find exogenous LL-37 unnecessary.

    Is LL-37 useful for chronic Lyme disease?

    This is one of the most common off-label indications, but the evidence base is weak. The theoretical rationale is reasonable: LL-37 has activity against Borrelia in vitro, and chronic Lyme involves both active infection and immune dysregulation. In practice, LL-37 is used as one component of multi-modal Lyme protocols including conventional antibiotics, herbal antimicrobials, biofilm disruptors, and immune support. Published clinical trials for LL-37 specifically in chronic Lyme are essentially absent. Users pursuing this indication should do so under Lyme-literate clinician supervision rather than solo, and should maintain realistic expectations: LL-37 is adjunctive, not curative, for complex chronic infections.

    Can I use LL-37 topically for skin infections or wounds?

    Topical use has the most clinical evidence. Phase II trials of topical LL-37 for chronic venous leg ulcers have shown benefit, and this is the most likely first FDA-approved indication. For chronic infected wounds, diabetic foot ulcers, and similar applications, topical LL-37 combined with proper wound care is supported by emerging evidence. For acute simple skin infections, topical LL-37 is generally not necessary — standard antibiotics work well. Topical formulation requires compounding pharmacy preparation; you cannot effectively apply lyophilized peptide reconstituted in water to a wound.

    What are the most common side effects of LL-37 injection?

    Injection site reactions are substantially more prominent with LL-37 than with many peptides — expect red, sore, sometimes itchy injection sites for 24-48 hours, especially early in use. Systemic effects vary: some users note mild flu-like symptoms (low-grade fever, fatigue, joint aches) in the first few doses. Most side effects diminish with continued dosing as the body adapts. The concerning side effects are uncommon but serious: worsening of existing psoriasis/rosacea, new-onset inflammatory skin disease, and (rarely) severe allergic reactions. If injection site reactions are severe or persistent beyond 72 hours, or if you develop new systemic symptoms, stop and consult a clinician.

    Can LL-37 help with long COVID?

    Theoretically possible but unproven, and use requires caution. LL-37 has antiviral activity against SARS-CoV-2 in vitro, and low endogenous LL-37 (low vitamin D) is associated with worse COVID outcomes. Some long COVID protocols include LL-37 for immune support and lingering viral activity. However, long COVID involves immune dysregulation and inflammation — contexts where LL-37's pro-inflammatory potential could theoretically worsen symptoms in some patients. Use cautiously, at lower doses (250 μg rather than 500 μg initially), monitor for worsening, and combine with other modalities rather than relying on LL-37 alone. Work with a clinician experienced in long COVID management.

    How does LL-37 compare to Thymosin Alpha-1 for immune support?

    Completely different mechanisms with complementary roles. Tα1 modulates adaptive immunity — enhancing T-cell maturation, dendritic cell function, vaccine response, and overall immune coordination. It is safer, better studied, and more appropriate for chronic immune support. LL-37 provides direct antimicrobial activity against bacteria, fungi, and some viruses, plus innate immune modulation. It has a narrower therapeutic window and more side-effect concerns. In practice, many chronic-infection protocols use both — LL-37 for antimicrobial coverage, Tα1 for adaptive immune restoration. For general wellness or aging immune support without specific infection target, Tα1 is usually the better choice; for active chronic infection where antimicrobial activity is desired, adding LL-37 makes more sense.

    Is LL-37 safe for long-term use?

    Long-term safety is not well characterized. Published clinical trials typically run weeks to months, not years. The theoretical concerns with chronic use include: (1) potential renal effects from cumulative cationic peptide exposure; (2) risk of inducing inflammatory skin disease in susceptible individuals over time; (3) potential effects on skin and mucosal microbiome from chronic antimicrobial activity; (4) uncharacterized effects on chronic inflammatory processes. Most users on LL-37 for chronic indications use intermittent cyclical protocols (8-week courses with breaks) rather than continuous daily use. Continuous daily LL-37 for more than several months is an uncharacterized regimen.

    Where does endogenous LL-37 come from and how can I boost it naturally?

    LL-37 is produced primarily by neutrophils (stored in granules), mucosal epithelial cells (respiratory, GI, urinary tracts), keratinocytes (skin), and sebaceous gland cells. The main natural factors that boost endogenous LL-37 production: (1) vitamin D sufficiency — the single most important factor, as vitamin D directly upregulates CAMP gene expression; (2) adequate sleep and circadian organization — disrupted circadian rhythms reduce cathelicidin expression; (3) exercise — moderate exercise boosts mucosal and circulating LL-37; (4) certain diet components (butyrate from fiber fermentation, vitamin A, adequate protein); (5) reduced chronic stress — chronic cortisol suppresses LL-37 production. Optimizing these factors often delivers meaningful endogenous LL-37 elevation without requiring exogenous peptide. For most users, vitamin D optimization alone produces a substantial increase in endogenous LL-37.

    Research Tools

    Related Compounds

    View All

    Larazotide (AT-1001)

    Immune & InflammationPhase 3

    Larazotide is an eight amino acid peptide with the sequence glycine-glycine-valine-leucine-valine-glutamine-proline-glycine, usually supplied as the acetate salt.

    t½ Not established as a systemic value. Larazotide is designed to act locally in the intestinal lumen and is given orally rather than for systemic exposure (PMID: 33881350); single-dose safety, tolerance and pharmacokinetics were assessed in a phase 1b study in celiac disease subjects (PMID: 17697209)
    PreclinicalView Profile

    Thymosin Alpha-1 (TA1)

    Immune & InflammationFDA Approved

    Thymosin alpha-1 (Tα1) is a 28-amino-acid N-acetylated peptide (N-Ac-Ser-Asp-Ala-Ala-Val-Asp-Thr-Ser-Ser-Glu-Ile-Thr-Thr-Lys-Asp-Leu-Lys-Glu-Lys-Lys-Glu-Val-Val-Glu-Glu-Ala-Glu-Asn) isolated and characterized by Allan Goldstein's laboratory at George Washington University in the 1970s as the immunologically active cleavage product of a larger precursor (prothymosin alpha) found in thymic tissue.

    t½ ~2 hours 1,600 mcg (1.6 mg) per injection (standard clinical dose)
    701 PubMedView Profile

    Side-by-Side Comparisons

    All Comparisons

    Compare LL-37 head-to-head: mechanism, half-life, dosing, safety, and vendor prices.

    Free 2026 Peptide Cheat Sheet (PDF)

    38 compounds and blends: vial sizes, BAC water volumes, dosing ranges and bloodwork markers.

    Download Free

    Need bloodwork before starting?

    Full hormone + metabolic panels from Anabolic Insights. Code CHONCH for first-order discount.