Recovery & Healing
Peptides and compounds studied for tissue repair, healing, and regeneration.
Suggested Compounds
Also known as: Body Protection Compound, Pentadecapeptide, BPC, Repair Balm
BPC-157 (Body Protection Compound-157) is a synthetic pentadecapeptide consisting of 15 amino acids (Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val) derived from a partial sequence of human gastric juice protein BPC. It has a molecular weight of 1419.53 Da and a CAS number of 137525-51-0. BPC-157 is classified as a stable gastric pentadecapeptide because it resists hydrolysis by gastric acid and digestive enzymes, a property that differentiates it from most bioactive peptides and enables oral bioavailability in preclinical models (PMID: 21524250). As of 2026, BPC-157 has been investigated in more than 90 published preclinical studies spanning models of gastrointestinal injury, tendon and ligament damage, nerve injury, wound healing, and organ protection. A complete review by Sikiric et al. (2011) established BPC-157 as a peptide with broad cytoprotective and regenerative properties across multiple organ systems (PMID: 21524250). Subsequent work by Seiwerth et al. (2022) expanded the evidence base to include vascular protection and modulation of the nitric oxide (NO) system as a central integrative mechanism (PMID: 36416831). BPC-157 is not approved by the United States Food and Drug Administration (FDA) for any therapeutic indication. It is classified under the World Anti-Doping Agency (WADA) Prohibited List category S0 (non-approved substances), making it banned in competitive sport. Despite the lack of regulatory approval, BPC-157 is widely used in the research peptide and biohacking communities, primarily administered via subcutaneous injection or oral capsule for musculoskeletal recovery and gut healing. Preclinical studies have demonstrated that BPC-157 accelerates healing of transected rat Achilles tendons, with treated animals showing superior biomechanical tendon strength at 14 days post-injury compared to controls (PMID: 30915550). In gastrointestinal models, BPC-157 has shown protective effects against NSAID-induced gastric lesions, ethanol-induced mucosal damage, and inflammatory bowel disease (IBD) analogs including experimentally induced colitis (PMID: 29898088). The peptide has also demonstrated neuroprotective activity in dopaminergic and serotonergic systems, counteracting lesions caused by neurotoxins in rodent models (PMID: 21524250). A 2025 pilot safety study by Lee et al. represents the first published human intravenous (IV) administration data for BPC-157. In this small cohort, IV BPC-157 was administered at escalating doses with no serious adverse events reported and no clinically significant changes in laboratory parameters (PMID: 40131143). While this study was not powered to establish efficacy, it provided the first formal human safety signal for the peptide. BPC-157 has also been shown to upregulate growth hormone receptor (GHR) expression in animal models, suggesting a possible synergistic effect when combined with growth hormone secretagogues (PMID: 30175840). The peptide is typically supplied as a lyophilized powder requiring reconstitution with bacteriostatic water. Lyophilized BPC-157 should be stored at -20 degrees Celsius in a desiccated environment; once reconstituted, it should be refrigerated at 2-8 degrees Celsius and used within 28 days to maintain peptide integrity.
Also known as: Thymosin Beta-4, TB4, TB 500
TB-500 is a synthetic peptide fragment of thymosin beta-4 (Tbeta4), a 43-amino-acid protein that is one of the most abundant intracellular actin-sequestering molecules in mammalian cells. With a molecular weight of approximately 4963 Da, TB-500 encompasses the active region of thymosin beta-4 responsible for actin binding, cell migration, and wound healing. Thymosin beta-4 was originally isolated from calf thymus tissue and later identified as a ubiquitous cytoplasmic protein expressed in virtually all nucleated cells (PMID: 20549306). The foundational review by Goldstein et al. (2005) established thymosin beta-4 as a multifunctional regenerative peptide with roles spanning wound healing, angiogenesis, anti-inflammation, and cardiac repair (PMID: 20549306). Unlike many bioactive peptides, thymosin beta-4 is not a hormone or cytokine but rather an intracellular actin-regulatory protein that, when released extracellularly following injury, initiates paracrine signaling cascades that drive tissue repair. TB-500 has been studied extensively in preclinical models of cardiac injury. Bock-Marquette et al. (2004) demonstrated that thymosin beta-4 promotes survival of cardiomyocytes after experimental myocardial infarction in mice, reduces infarct size, and improves cardiac function (PMID: 18286466). The mechanism involves activation of the Akt (protein kinase B) survival pathway and migration of cardiac progenitor cells to the injury site. These findings have positioned thymosin beta-4 as a candidate cardiac repair agent, though clinical translation has been limited. In wound healing research, thymosin beta-4 accelerates dermal wound closure by promoting keratinocyte and endothelial cell migration, increasing angiogenesis, and reducing inflammation at the wound site. Philp et al. (2004) showed that topical thymosin beta-4 significantly accelerated full-thickness wound closure in diabetic and aged mouse models (PMID: 25613625). The peptide promotes collagen deposition and extracellular matrix remodeling, resulting in improved scar quality. TB-500 has also shown efficacy in corneal wound healing models. Sosne et al. demonstrated that thymosin beta-4 eye drops accelerate corneal epithelial wound closure and reduce inflammation after chemical or mechanical injury, leading to ophthalmic clinical trials (Phase 2) for neurotrophic keratopathy and dry eye disease. This represents the most advanced clinical development program for any thymosin beta-4-based therapeutic. TB-500 is not FDA-approved for any human therapeutic indication. It is widely used in the equine veterinary space and in the human peptide biohacking community, primarily administered via subcutaneous injection for musculoskeletal recovery, wound healing, and anti-inflammatory effects. The typical reconstitution protocol involves bacteriostatic water, with the lyophilized peptide stored at -20 degrees Celsius and the reconstituted solution refrigerated at 2-8 degrees Celsius. The standard loading protocol in community use involves higher initial doses (typically 2-2.5 mg twice weekly for 4-6 weeks) followed by lower maintenance doses.
Also known as: BPC/TB Blend, BPC TB Stack
Combined healing peptide blend
Also known as: Copper Peptide, GHK Copper
GHK-Cu (copper peptide, glycyl-L-histidyl-L-lysine:copper(II)) is a naturally occurring tripeptide-copper complex with the amino acid sequence Gly-His-Lys chelated to a copper(II) ion. It has a molecular weight of 403.93 Da and a CAS number of 49557-75-7. GHK-Cu was first identified in human plasma by Pickart and Thaler in 1973, who observed that plasma from young individuals (age 20-25) stimulated hepatocyte protein synthesis more effectively than plasma from older donors (age 60-80), and isolated GHK as the active factor (PMID: 25815018). GHK-Cu is present in human plasma at approximately 200 ng/mL in young adults, with concentrations declining significantly with age β dropping to approximately 80 ng/mL by age 60. This age-related decline in GHK-Cu has been proposed as a contributing factor to reduced tissue repair capacity, skin thinning, and slower wound healing observed in aging populations (PMID: 25815018). A landmark gene expression study by Pickart et al. (2012) using the Broad Institute Connectivity Map demonstrated that GHK-Cu modulates the expression of over 4,000 human genes, with a net effect that shifts gene expression patterns from a diseased or aged state toward a healthier, younger profile. Key upregulated gene categories include collagen synthesis, antioxidant defense, DNA repair, and anti-inflammatory pathways. Key downregulated categories include pro-inflammatory cytokines, fibrinogen production, and metastasis-related genes (PMID: 22585403). In wound healing research, GHK-Cu has demonstrated strong efficacy across multiple models. Topical GHK-Cu accelerates wound contraction, stimulates angiogenesis, and increases collagen deposition in dermal wounds. It activates fibroblasts and attracts immune cells including macrophages and mast cells to the wound site, coordinating the inflammatory-to-proliferative phase transition (PMID: 28500824). In aged skin models, GHK-Cu restored dermal thickness and improved skin elasticity through stimulation of collagen I and III synthesis and inhibition of excessive matrix metalloproteinase (MMP) activity (PMID: 24508067). GHK-Cu is widely available as a cosmetic ingredient in serums, creams, and dermal patches. It is approved for cosmetic use in the United States and European Union. Beyond topical application, GHK-Cu is also administered via subcutaneous injection in the biohacking community for systemic anti-aging and recovery purposes, though this route lacks formal clinical validation. The peptide complex is relatively stable when lyophilized and should be stored at 2-8 degrees Celsius for topical formulations or at -20 degrees Celsius for injectable-grade lyophilized powder. GHK-Cu has an extremely short plasma half-life of approximately 30 minutes, but its tissue-level effects persist for hours to days due to gene expression changes it initiates upon cellular uptake.
Also known as: Lys-Pro-Val
KPV is a three-amino-acid peptide β Lysine-Proline-Valine β that makes up the C-terminal tail of alpha-MSH (alpha-melanocyte-stimulating hormone). With a molecular weight of only 342.4 Da, it is one of the smallest peptides in the research space, yet it preserves much of the anti-inflammatory activity of the parent 13-amino-acid alpha-MSH hormone without the pigmentation, sexual, or melanocortin-receptor effects that make full-length alpha-MSH (and analogs like Melanotan II and PT-141) unsuitable for chronic anti-inflammatory use. That "anti-inflammation without the side-effect profile" is why KPV has been studied for more than three decades in conditions ranging from ulcerative colitis to atopic dermatitis to allergic airway inflammation. KPV was first characterized as the minimal anti-inflammatory fragment of alpha-MSH in the 1980s and 1990s. Researchers systematically truncated alpha-MSH (SYSMEHFRWGKPV) from both ends and tested each fragment in inflammatory models. The C-terminal tripeptide KPV turned out to be the "business end" for inflammation suppression β while the N-terminal sequences were responsible for pigmentation and melanocortin receptor binding. This finding β that you could keep the anti-inflammatory activity while shedding most of the hormone's other pharmacology β launched a research program that continues today (Luger et al., 2003). The mechanism is unusual for a tripeptide. KPV does not appear to act primarily through classical melanocortin receptors (MC1R-MC5R). Instead, the current working model is that KPV is taken up into intestinal and immune cells via the peptide transporter PepT1 (SLC15A1), which is upregulated on inflamed epithelium. Once inside, KPV inhibits NF-kB signaling β the master inflammatory transcription factor β and downregulates the production of TNF-alpha, IL-1, IL-6, IL-8, and other pro-inflammatory cytokines. The PepT1 pathway gives KPV a degree of "self-targeting" to inflamed tissue, which is part of why oral dosing has shown activity in colitis models despite the peptide being too small to behave like a conventional biologic (Dalmasso et al., 2008, Kannengiesser et al., 2008). Research on KPV falls into three rough buckets. The first is gastrointestinal inflammation: ulcerative colitis, Crohn's disease, and inflammatory bowel disease more broadly. Both oral and rectal administration have been studied, with oral nanoparticle formulations showing particular promise in murine DSS colitis models. The second is skin inflammation: atopic dermatitis, psoriasis, contact dermatitis, and wound healing. Topical formulations have been studied as far back as the 1990s. The third is airway and systemic inflammation: allergic asthma, allergic rhinitis, and systemic inflammatory conditions. Across all three, the pattern is the same β KPV reduces pro-inflammatory cytokines and cellular infiltration without producing the immunosuppression seen with steroids or TNF inhibitors. KPV is not FDA-approved for any indication. It exists entirely in the research-peptide and compounding-pharmacy grey zone. It is not scheduled or controlled, but it is also not legally marketable as a treatment in the United States. Human data remain limited β most of the evidence base is preclinical (cell culture and rodent models), with only a handful of small human case series published. This is important framing: KPV is one of the better-characterized "research" peptides, but it is nowhere near the level of human evidence that supports BPC-157, TB-500, or the GLP-1 agonists like Semaglutide. The popularity of KPV in the nootropic/peptide community has grown steadily because of three practical features. First, it is one of the few peptides with documented oral and topical activity β you do not need injections. Second, it has a clean safety profile in the published literature, with no serious adverse events reported across the studies published to date. Third, it stacks logically with other repair peptides β pairing KPV for inflammation control with BPC-157 and TB-500 for tissue repair is a common "gut healing" protocol in the community, even though controlled human data for the stack do not exist. If you are considering KPV, the honest framing is this: the preclinical case for anti-inflammatory activity is strong and consistent, the mechanism (PepT1-mediated NF-kB inhibition) is plausible and well-documented, and the safety signal is reassuring β but human evidence is thin and the compound is not regulated as a therapeutic. Everything below reflects what the published literature reports and what the research community has converged on as conservative practice. It is not medical advice and it is not a substitute for a physician's evaluation of inflammatory or autoimmune conditions.
Also known as: Polydeoxyribonucleotide, Placentex, Nucleofill, Salmon DNA, Nucleotide polymer
PDRN (Polydeoxyribonucleotide) is a biotechnological compound derived from salmon sperm DNA (Oncorhynchus mykiss) through extraction, purification, and fractionation. It consists of polynucleotide chains with molecular weights ranging from 50 to 1500 kDa. PDRN is widely used in Asian aesthetic medicine (particularly South Korea) for skin rejuvenation, wound healing, and hair loss treatment. It is available as an injectable sterile solution (Placentex Integro) licensed in several countries, as well as topical formulations and cosmetic creams. PDRN's mechanism centers on adenosine A2A receptor activation, stimulating collagen synthesis, cellular proliferation, and anti-inflammatory pathways. It is one of the few compounds in this catalog with a substantial published clinical (Phase 4) evidence base in aesthetic applications.
Also known as: Ta1
Thymosin alpha-1 (TΞ±1) is a 28-amino-acid N-acetylated peptide (N-Ac-Ser-Asp-Ala-Ala-Val-Asp-Thr-Ser-Ser-Glu-Ile-Thr-Thr-Lys-Asp-Leu-Lys-Glu-Lys-Lys-Glu-Val-Val-Glu-Glu-Ala-Glu-Asn) isolated and characterized by Allan Goldstein's laboratory at George Washington University in the 1970s as the immunologically active cleavage product of a larger precursor (prothymosin alpha) found in thymic tissue. The thymus gland is the primary site of T-cell maturation in early life, and thymic hormones have long been implicated in immune competence. Goldstein's isolation of TΞ±1 opened decades of research into whether supplementation with thymic peptides could restore immune function in contexts of thymic atrophy (aging, chemotherapy, HIV, chronic viral infection) or augment immune response against infections and malignancies. Synthetic TΞ±1 (under the brand name Zadaxin, manufactured by SciClone Pharmaceuticals) has been approved in more than 30 countries for chronic hepatitis B, chronic hepatitis C, and as an immune adjuvant for influenza and hepatitis B vaccines in immunocompromised patients, as well as adjunctive therapy in certain cancers. In the United States, TΞ±1 is not FDA-approved but has held orphan drug designation for several indications and is commonly available through compounding pharmacies for off-label use (Goldstein et al., 1977, Garaci et al., 2003). The mechanistic framing for TΞ±1 is best understood as a pleiotropic immune modulator rather than a simple immune "booster." TΞ±1 acts primarily through Toll-like receptors (especially TLR9 and TLR2) on dendritic cells and other antigen-presenting cells, driving dendritic cell maturation, promoting balanced Th1/Th2 responses, improving T-cell differentiation from thymic and extra-thymic precursors, stimulating natural killer cell activity, and modulating inflammatory cytokine patterns. The practical result in patients with chronic viral infections or immunocompromise is improved viral clearance, enhanced vaccine response, and more balanced immune reactivity. Importantly, TΞ±1 does not produce generalized immune activation or autoimmunity at therapeutic doses β it shifts immune response patterns rather than simply amplifying inflammation. This selective modulation is what has made TΞ±1 clinically attractive in contexts where straightforward immune activation would cause harm (Romani et al., 2012, Li et al., 2010). In everyday off-label use outside strictly approved indications, TΞ±1 is pursued by three main user groups. First, people with chronic viral infections (EBV reactivation, chronic Lyme complex, long COVID, chronic hepatitis, HIV as adjunct to antiretrovirals) use TΞ±1 for immune support alongside primary therapy. Second, older adults with age-related thymic atrophy and declining CD4/CD8 ratios use TΞ±1 as a general immunity-preservation strategy, often in combination with other longevity-oriented peptides like BPC-157 and Epithalon. Third, cancer patients in remission or undergoing certain immunotherapies use TΞ±1 as adjunctive immune support, ideally under oncologic supervision. Competitive athletes sometimes use TΞ±1 during heavy training cycles on the theory that exercise-induced transient immune suppression can be buffered, though this use case has weak formal evidence (Garaci et al., 2007). TΞ±1 has one of the cleanest safety profiles among peptides with substantial bioactivity β decades of clinical use with minimal adverse events, no significant organ toxicity, and no autoimmunity signal at therapeutic doses. The main practical limitations are the cost of good-quality TΞ±1 preparations, the injectable route (TΞ±1 is not orally bioavailable), and the uncertainty around whether long-term routine supplementation meaningfully delays age-related immune decline in healthy individuals. This entry covers TΞ±1's established mechanism and indications, the emerging research in long COVID and other post-viral syndromes, and the practical considerations for anyone exploring TΞ±1 for immune support. Related peptides frequently stacked or compared include BPC-157 and TB-500 for general tissue repair, Epithalon for parallel longevity positioning, and LL-37 for a very different (antimicrobial rather than immune-modulating) peptide category.
Also known as: Thymalinum, Timalin, Thymus Peptide Complex, Thymic Extract, Khavinson Thymalin, T-activin (related), Thymalin-Vialing
Thymalin is a thymus-derived peptide complex developed in the 1970s by Vladimir Khavinson and the Leningrad (now St. Petersburg) Institute of Bioregulation and Gerontology as part of a broader program to identify tissue-specific regulatory peptides from mammalian organs. Produced by acetic acid extraction of bovine or calf thymus tissue and fractionated to yield a mixture of short polypeptides (average molecular weight 1-10 kDa), Thymalin occupies a distinctive position in peptide medicine: it is a registered pharmaceutical in Russia with over four decades of clinical use for immune restoration in aging and immunosuppressed populations, while remaining a research-chemical-status peptide in the United States and most Western markets where its evidence base is poorly integrated into mainstream medicine. Understanding Thymalin requires understanding the Russian peptide bioregulator tradition that produced it β a clinical and scientific framework quite different from Western pharmaceutical development, with its own standards of evidence, its own terminology, and its own strengths and limitations. Structurally, Thymalin is not a single molecule but a mixture of short polypeptides and oligopeptides derived from calf thymus gland. The specific peptide composition has been partially characterized in modern analytical work but never fully standardized in the way a single synthetic peptide would be. Active fractions include peptides with sequences overlapping Thymosin Alpha-1 and Thymulin, along with additional short regulatory peptides including the Khavinson lab's signature short synthetic peptides Epithalon (AEDG, from pineal) and related oligopeptides. The presumed active principle is a combination of these peptides acting synergistically on the immune system, though Khavinson's group has emphasized in their publications that the specific short peptides β which can be synthesized and studied individually β reproduce much of the biological activity of the whole extract. This is the foundation of the modern short-peptide Khavinson framework: Thymalin was the original mixture, and the individual dipeptides (like Livagen, Ala-Glu-Asp-Gly) and tetrapeptides (like Epithalon) identified from Thymalin and related extracts are the modern synthetic versions. Functionally, Thymalin is described by its developers as a "cytomedine" β a tissue-derived peptide regulator that carries organ-specific signals for cellular homeostasis and regeneration. The framework proposes that short peptides from specific tissues can enter cells (via membrane transport or endocytosis), travel to the nucleus, and interact with specific gene promoters to regulate transcription of tissue-specific genes. For Thymalin, this means carrying signals that promote thymic function, T-cell differentiation, and broader immune system homeostasis. The framework is provocative and not universally accepted in Western molecular biology β the specific proposition that exogenous short peptides can directly regulate gene transcription by binding promoters is considered unproven by most Western molecular biologists β but it has produced a coherent clinical research program with measurable outcomes in human trials. The clinical evidence base for Thymalin is substantial in volume and spans decades of use in Russian medicine. Khavinson and colleagues have published over two hundred papers on Thymalin and its derivatives, including multi-decade longitudinal trials in elderly populations showing reduced all-cause mortality, reduced incidence of acute respiratory infections, improvements in T-cell subset profiles (particularly CD4+ cells and the CD4:CD8 ratio), improved wound healing, and improvements in broader markers of immune competence and healthy aging. The most frequently cited data come from the "Kiev study" and subsequent Russian elderly cohort trials in which Thymalin (often in combination with Epithalon) administered in 10-day courses annually or biannually to elderly patients produced 2-fold reductions in cumulative 6-8 year mortality versus untreated controls. These are notable claims that would be transformative if replicated in a Western rigorous RCT framework β and the honest framing is that they have not been, not because replication has been attempted and failed, but because the Western peer-reviewed system has not seriously engaged with the Russian peptide bioregulator literature. This is an epistemic gap rather than a proven falsification, and it is the gap that every Western user of Thymalin should understand. Regulatory status varies dramatically by jurisdiction. In Russia, Thymalin is a registered pharmaceutical product (trade name Thymalin or Timalin) with Russian Ministry of Health approval for specific indications including post-infectious immune restoration, aging-related immunosuppression, radiation-induced immune compromise, and post-surgical immune support. It is prescribed routinely in Russian and some former Soviet clinical practice, particularly in geriatric medicine and oncology. In the United States, European Union, and most Western markets, Thymalin is not an approved pharmaceutical and is sold in the research-chemical peptide market β often imported directly from Russian manufacturers or compounded by specialty peptide suppliers. The research-chemical framing does not mean it is unsafe (its Russian safety record is substantial), but it means quality control is not regulated, pharmaceutical-grade standards are not guaranteed, and use is outside the framework of Western regulatory approval. The thymus biology context matters. The thymus is the organ where T-lymphocytes mature and are educated to distinguish self from non-self. Thymic function peaks in early childhood and then declines progressively through adulthood, a process called thymic involution β the thymus is largely replaced by fatty tissue by age 70 in most individuals, with corresponding decline in T-cell output and immune function. The elderly immune system is characterized by reduced naive T-cell pools, shrinking T-cell receptor diversity, expansion of senescent T-cell clones, and increased vulnerability to infections and cancer. The thymic-peptide hypothesis proposes that exogenous thymic signals can partially reverse or slow this involution and restore functional immune capacity. The biology is plausible; the clinical reality is harder to verify in Western-standards trials. In the research-peptide community outside Russia, Thymalin is used for immune support in contexts including aging, chronic infection recovery, post-chemotherapy immune restoration, chronic fatigue and post-viral syndromes, autoimmune disease management (controversial β thymic peptides might be immunomodulatory in either direction), and general longevity protocols. It is frequently combined with Epithalon (the Khavinson pineal tetrapeptide) as the canonical "Khavinson stack" reflecting the original clinical protocols. This entry covers Thymalin's composition and the cytomedine framework, the Khavinson clinical evidence base and its epistemic status, the distinction between Thymalin (mixture) and Thymosin Alpha-1 (single synthetic peptide, separate development track) and Thymulin (a zinc-dependent single peptide also distinct from Thymalin), the practical use case framing for Western research-peptide users, appropriate dosing based on Russian clinical protocols, the safety profile (substantial safety record in Russia, reasonably clean side-effect profile, but real questions about quality control in the Western research-chemical market), and honest skepticism about the grander anti-aging claims without dismissing the underlying immune-restoration evidence.
Also known as: Glu-Trp
Thymogen (also transliterated Timogen or β¨Γ³β¨ββ¨ββ¨ββ¨ββ¨β‘β¨β) is a synthetic dipeptide β glutamyl-tryptophan (Glu-Trp, or EW) β developed by the St Petersburg Institute of Bioregulation and Gerontology under Professor Vladimir Khavinson. Thymogen belongs to the same family of Russian short-peptide bioregulators as Pinealon, Epitalon, Vilon, and the broader Khavinson catalog, but unlike those neural and general-aging peptides, Thymogen specifically targets thymus-dependent cellular immunity. The compound originated in the late 1970s and 1980s when Khavinson and colleagues began isolating and characterizing bioactive peptide fractions from calf thymus tissue. The parent peptide extract β called Thymalin (a mixture of thymus-derived peptides) β was developed in parallel and remains a Russian clinical product for immune modulation. Thymogen was subsequently identified as one of the active short-peptide components of the Thymalin extract and was synthesized as a defined dipeptide for clinical use. The Glu-Trp sequence is notable for its simplicity β only two amino acids β and for its resistance to rapid proteolytic degradation compared with longer peptides. Thymogen has been registered in Russia as a pharmaceutical since the late 1980s, carrying the Russian registration for use in cellular immunodeficiency states, post-surgical and post-burn immune support, acute and chronic purulent infections, and as adjunctive therapy in certain oncologic and radiotherapy contexts. It is available commercially as nasal drops, an injectable solution, and an oral formulation, and has been used in Russian clinical practice continuously for decades. Outside Russia, it remains an unapproved research peptide, available through research-chemical suppliers and informally in body-hacking communities as an immune support peptide. The Khavinson framework around Thymogen holds that short peptides derived from thymus tissue retain the ability to signal to T-cell progenitors and mature T-cells β upregulating thymus-dependent immune function, supporting T-helper and T-cytotoxic cell maturation, and restoring immune competence in states of age-related thymic involution or acquired immunodeficiency. This is theoretically coherent with the thymus's known role in T-cell education and differentiation, and it parallels the better-known synthetic thymus-derived peptides developed in Western medicine, including thymosin alpha-1 (Zadaxin), which is FDA-approved in some jurisdictions for hepatitis B and as an adjunctive immune therapy. This entry takes the honest position that Thymogen is a registered Russian pharmaceutical peptide with extensive domestic clinical use, moderate Russian and limited Western preclinical support, plausible mechanism of action consistent with the Western thymic peptide literature, and an unapproved-research-peptide status in most Western jurisdictions. It is not a supplement and not approved outside Russia. Users engaging with it through research-chemical channels should expect Russian clinical practice levels of characterization rather than FDA-approval levels. For readers exploring the broader Khavinson peptide space, see Pinealon, Epitalon, Vilon, Cartalax, Livagen, and related entries. For the closest Western-approved comparator, see thymosin alpha-1. For other immune-supportive peptides in the catalog, see KPV and BPC-157.
LL-37 is the only human cathelicidin, a 37-amino-acid amphipathic alpha-helical peptide ([LL-37, 37 aa]) cleaved from the C-terminus of the 170-amino-acid precursor hCAP-18 (human cationic antimicrobial protein, 18 kDa), which is encoded by the CAMP gene on chromosome 3p21.31. The "LL" in its name refers to the two leucine residues at the N-terminus; "37" is the length. LL-37 is stored in the secondary granules of neutrophils and produced by mucosal epithelial cells, keratinocytes, sebocytes, and certain lymphocyte populations, where it serves as a core component of the innate immune system β one of the evolutionarily ancient defenses that operates without requiring prior antigen exposure or adaptive immune priming. The peptide was first isolated in 1995 by JΓΌrgen Gudmundsson, Birgitta Agerberth, and colleagues at the Karolinska Institute, and has since been the subject of more than 5,000 published studies exploring its roles in infection defense, wound healing, inflammation modulation, angiogenesis, and (paradoxically) inflammatory disease pathogenesis (Gudmundsson et al., 1996, Vandamme et al., 2012). LL-37's mechanism of antimicrobial action is fundamentally different from conventional antibiotics. Where small-molecule antibiotics target specific bacterial enzymes or structures (ribosomes, cell wall synthesis, DNA gyrase), LL-37 operates by direct physical disruption of microbial membranes. The peptide is cationic (net charge +6) and amphipathic β one face of the alpha-helix is hydrophobic, the other hydrophilic β which allows it to insert into negatively charged bacterial membranes (rich in phosphatidylglycerol and cardiolipin) while largely sparing mammalian cell membranes (rich in zwitterionic phosphatidylcholine and cholesterol). Once inserted, LL-37 forms transient pores, disrupts membrane potential, and kills the target organism. This mechanism is active against a broad spectrum β gram-positive and gram-negative bacteria, mycobacteria (including M. tuberculosis), fungi (Candida species), some enveloped viruses, and even biofilm-embedded organisms that resist conventional antibiotics (DΓΌrr et al., 2006). Crucially, the membrane-disruption mechanism makes resistance development slower and more difficult than with molecular-target antibiotics β bacteria cannot easily redesign the bulk charge and composition of their membranes without compromising viability. Beyond direct antimicrobial effects, LL-37 has important immunomodulatory roles. It recruits neutrophils, monocytes, T cells, and mast cells to sites of infection; modulates cytokine production by immune cells; promotes wound re-epithelialization and angiogenesis; and interacts with pattern-recognition receptors (TLR, FPR2/ALX, P2X7) to shape innate immune responses. This immunomodulation is largely protective, but LL-37 has also been implicated in the pathogenesis of certain chronic inflammatory conditions β most notably rosacea (where cathelicidin processing is dysregulated leading to pathological LL-37 fragments) and psoriasis (where LL-37 complexed with self-DNA activates plasmacytoid dendritic cells via TLR9, driving the Th17 inflammatory cascade characteristic of the disease). This dual role β protective in acute infection, pathogenic when dysregulated in chronic inflammatory disease β is a recurring theme in cathelicidin biology (Yamasaki et al., 2007, Lande et al., 2007). In clinical use, LL-37 has been investigated as a topical treatment for chronic infected wounds and diabetic foot ulcers (with some positive results in early trials but no approved product), as an adjunct to eradicate biofilm-related infections, and β more controversially in peptide-user communities β as a subcutaneous injection for systemic antimicrobial activity in chronic Lyme disease, chronic infections, and immune dysregulation syndromes. The peptide-community use is not supported by rigorous trial evidence, and the theoretical concerns are significant: systemic LL-37 at therapeutic antimicrobial concentrations has narrow margins between pharmacologic and toxic effects because the same membrane-disrupting activity that kills bacteria can also damage mammalian membranes at sufficient concentrations. LL-37 also has pro-inflammatory potential at certain doses and in certain disease contexts. This entry covers the established biology of LL-37, the legitimate research interest, and the considerable uncertainty around off-label human use (Hilchie et al., 2013). LL-37 is frequently discussed alongside other peptides with overlapping or complementary roles. Cross-references include Thymosin-Alpha-1 for adaptive immune modulation, BPC-157 for tissue repair and vascular protection, and TB-500 for wound healing and actin biology. Unlike TΞ±1 which modulates host immunity to fight infection, LL-37 has direct antimicrobial activity β the two can be complementary in chronic infection contexts.
Also known as: HNG
Humanin is a 24-amino-acid peptide (MAPRGFSCLLLLTSEIDLPVKRRA) encoded within the mitochondrial 16S ribosomal RNA gene and translated from a short open reading frame that was not recognized as biologically active until 2001, when Hashimoto and colleagues identified it in a screen for factors that protect neurons from Alzheimer's disease-associated toxicity (Hashimoto et al., 2001). The discovery was methodologically elegant: using a cDNA library from the occipital lobe of a patient who had died of Alzheimer's disease but whose specific brain region had remained clinically unaffected, they identified a peptide that protected cultured neurons from beta-amyloid toxicity, and traced its origin back to an unexpected locus in the mitochondrial genome. The finding launched an entire field β mitochondrial-derived peptides or MDPs β that now includes humanin, MOTS-c, SHLP1 through SHLP6, and related small peptides encoded within mitochondrial DNA that have systemic endocrine and autocrine signaling functions. Humanin itself has since been shown to protect cells from a range of stressors including beta-amyloid toxicity, Bax-induced apoptosis, oxidative stress, hypoxia-reoxygenation, and serum starvation (Guo et al., 2003; Tajima et al., 2002; Zhai et al., 2005). It also has metabolic effects including improved insulin sensitivity, enhanced glucose disposal, and protection against atherosclerosis in mouse models (Muzumdar et al., 2009). Plasma humanin concentrations are relatively high in young humans and decline with age, which has prompted speculation that restoring humanin to youthful levels could be a longevity intervention (Cobb et al., 2016). The practical reality of humanin as a research peptide is more complicated than the mechanism summary suggests. The endogenous peptide has a short circulating half-life (minutes), is rapidly cleared, and does not cross the blood-brain barrier efficiently in its native form. Synthetic analogs with substitutions to improve stability and potency have been developed β the most studied is HNG (humanin S14G), which is roughly 1000-fold more potent than wild-type humanin in several assays and has been used in most of the preclinical therapeutic work (Hashimoto et al., 2001; Yen et al., 2013). Other analogs with different substitution patterns (HNA, [Gly14]-HN, colivelin which fuses humanin with the activity-dependent neurotrophic factor peptide) have been generated for various experimental purposes. What is being sold as "humanin" by research-chemical peptide vendors is typically the wild-type 24-amino-acid sequence, not HNG, and the wild-type peptide has substantially less in vivo activity than the published HNG data would suggest. Consumers reading mechanism summaries that cite HNG mouse studies and then buying wild-type humanin are effectively purchasing a different compound than the one described in the research. Humanin has not been developed as an FDA-approved drug and has no human trial data establishing a therapeutic dose or efficacy profile. It remains an investigational peptide with strong mechanistic rationale, extensive preclinical evidence, and no clinical validation. This entry covers what the peptide actually does, how it signals through its receptor complex, what the animal data show in models of aging, neurodegeneration, diabetes, and cardiovascular disease, where the evidence is strongest and where it is thin, and what realistic use looks like for someone interested in mitochondrial-derived peptide biology. If the goal is neuroprotection or metabolic improvement, FDA-approved interventions (lifestyle, approved medications) should be fully explored first. If the goal is participating in the cutting edge of mitochondrial peptide research as a self-experimenter, this page is the most honest summary available of what the evidence does and does not support.
Also known as: Cibinetide
ARA-290, also known as Cibinetide or pHBSP (Helix B Surface Peptide), is an 11-amino-acid peptide β QEQLERALNSS β designed to mimic a specific region of the tissue-protective surface of erythropoietin (EPO) without activating the classical hematopoietic EPO receptor that drives red blood cell production. With a molecular weight of 1257 Da, ARA-290 was developed as a deliberate pharmaceutical engineering attempt to separate the tissue-protective and anti-inflammatory effects of EPO from its hematopoietic effects β producing a drug that could deliver the neuroprotective and healing properties of EPO without the clot risk, blood pressure elevation, and policing concerns that surround recombinant EPO use (Brines et al., 2008). The scientific story behind ARA-290 is unusual and worth understanding. Erythropoietin is best known as the kidney hormone that stimulates bone marrow to make red blood cells. But researchers noted in the early 2000s that recombinant EPO had unexpected protective effects in tissue injury models far removed from anemia β it reduced damage after stroke, reduced damage after heart attack, accelerated wound healing, reduced neuropathic pain, and dampened inflammation. These effects were too broad and too strong to be coincidence. The team led by Michael Brines and Anthony Cerami proposed and eventually confirmed that EPO has two distinct receptor targets: the classical EPO receptor homodimer (EPOR/EPOR) on bone marrow cells, which drives hematopoiesis, and a heteromeric "innate repair receptor" (IRR) consisting of EPOR + beta-common receptor, expressed on tissues like nerves, heart, brain, skin, and retina, which drives tissue protection and anti-inflammatory effects (Brines & Cerami, 2012). The engineering achievement with ARA-290 was to design a peptide that selectively activates the IRR without triggering the hematopoietic EPO receptor. The parent 11-amino-acid sequence was derived from the external surface of helix B of EPO β a region predicted to interact with the beta-common receptor component of the IRR. The engineered peptide binds the IRR and triggers its tissue-protective downstream signaling (JAK2/STAT3/STAT5, MAPK, Akt pathways) but does not meaningfully activate erythropoiesis. This means ARA-290 can be given at doses that produce strong anti-inflammatory and tissue-protective effects without raising hematocrit, increasing thrombosis risk, or producing hypertension β the primary safety concerns of EPO in non-anemia contexts. ARA-290's clinical development has focused primarily on neuropathic pain, especially small fiber neuropathy β a type of neuropathy involving damage to small unmyelinated C-fibers and thinly myelinated A-delta fibers, causing burning pain, allodynia, and autonomic symptoms. Small fiber neuropathy is common in diabetes, sarcoidosis, idiopathic etiologies, and several immune-mediated conditions. It is often refractory to conventional neuropathic pain drugs (gabapentin, pregabalin, duloxetine, tricyclic antidepressants). Multiple Phase 2 trials in sarcoidosis-associated small fiber neuropathy have shown ARA-290 significantly reduces pain scores and improves quality of life measures over 4-12 weeks of daily subcutaneous administration at 4 mg doses (Culver et al., 2017, Dahan et al., 2013). The mechanism in neuropathic pain involves tissue-level effects on inflammation, nerve fiber integrity, and small blood vessel function. ARA-290 reduces pro-inflammatory cytokine production, supports nerve fiber regeneration (measurable as increased intraepidermal nerve fiber density on skin biopsy in some trials), and modulates microvascular perfusion to nerves. The effects develop gradually over weeks of treatment, consistent with tissue-level healing rather than immediate analgesia. This gradual onset distinguishes ARA-290 from conventional neuropathic pain medications that work through ion channel modulation (Heij et al., 2012). Beyond sarcoidosis-associated neuropathy, ARA-290 has been studied in diabetic neuropathy, chemotherapy-induced neuropathy, neuropathic pain from other causes, and exploratory applications in inflammatory conditions. The pharmaceutical development has proceeded through Araim Pharmaceuticals, with ARA-290 (cibinetide) progressing through various phases of clinical trials. As of early 2026, ARA-290 is NOT FDA-approved as a drug β it exists as an investigational compound and research peptide. Availability in the community has come through research peptide suppliers rather than pharmaceutical channels, which introduces quality control and sourcing considerations that are not present with approved medications. The research peptide community has taken interest in ARA-290 primarily for three reasons. First, the mechanism β innate repair receptor activation with tissue-protective and anti-inflammatory signaling β is conceptually attractive for recovery, injury healing, and general "anti-aging" or "regenerative" applications. Second, the clinical evidence for neuropathic pain is more solid than for many research peptides, with multiple Phase 2 studies published in peer-reviewed journals. Third, the safety profile in clinical trials has been favorable β no thrombotic events, no hypertension, no elevated hematocrit, in line with the rational design goal of separating tissue protection from hematopoietic effects (Brines et al., 2015). The community uses of ARA-290 extend beyond the clinically-studied neuropathic pain indications. Common use patterns include: general tissue repair and anti-inflammatory support, adjunct therapy for chronic inflammation, recovery from injuries (soft tissue, post-surgical), diabetic complication support beyond neuropathy, exercise-related inflammation, autoimmune adjunct therapy, and experimental applications in various chronic conditions. Evidence for these community uses is sparse to nonexistent β they represent extrapolation from mechanism and from the neuropathic pain trial data rather than from direct clinical evidence. The honest framing for anyone considering ARA-290: the pharmacology is sophisticated and the clinical trial evidence for small fiber neuropathy (particularly sarcoidosis-associated) is among the better-supported applications in the research peptide space. Outside of that specific indication, use is mechanism-based and speculative. The safety profile in trials has been reassuring, but trial populations are limited and long-term safety data beyond months of use are sparse. It is NOT FDA-approved, and community use requires the caveats that accompany any research peptide: sourcing quality, injection technique, understanding that you are using a drug not yet approved for marketing, and acknowledgment that the evidence base beyond neuropathic pain is thin. For a specific indication like sarcoidosis-associated small fiber neuropathy in a patient who has failed conventional therapy, ARA-290 is a defensible consideration. For general wellness or anti-aging use, the evidence base does not support the substantial cost and complexity.
Also known as: IGF-1 Long R3
IGF-1 LR3 (Long R3 IGF-1) is a synthetic analog of human insulin-like growth factor 1 modified at two positions to dramatically extend its serum half-life and amplify its tissue bioactivity compared to native IGF-1. The "LR3" designation describes the two key modifications: "L" (Long): A 13-amino-acid N-terminal extension peptide added to the native 70-amino-acid IGF-1 sequence "R3": An arginine substitution at position 3 (replacing the native glutamic acid) Together these modifications produce a critical pharmacologic consequence: dramatically reduced binding affinity for the insulin-like growth factor binding proteins (IGFBPs), particularly IGFBP-3 which normally sequesters 95-99% of circulating IGF-1 in an inactive reservoir. Free (unbound) IGF-1 is the bioactive form that binds the IGF-1 receptor and drives muscle protein synthesis. By escaping IGFBP sequestration, IGF-1 LR3 produces: Serum half-life of 20-30 hours (native IGF-1: ~12 minutes) 3-10 times higher bioactive concentration in target tissues Stronger and more sustained IGF-1 receptor signaling per dose IGF-1 LR3 was originally developed by Francis et al. in the early 1990s at CSIRO Australia for cell culture applications β specifically, driving growth of mammalian cell lines in bioreactors where the IGFBPs from fetal bovine serum would otherwise neutralize added growth factor. This commercial research-chemical origin is the reason IGF-1 LR3 has been widely available in the research-peptide supply chain for decades despite never pursuing a clinical drug approval pathway. There is no FDA-approved indication for IGF-1 LR3 in human use. Mecasermin (recombinant native human IGF-1, Increlex) is FDA-approved for severe primary IGF-1 deficiency in children but is mechanistically very different β it is native IGF-1 with normal IGFBP binding and a short half-life. Off-label and research-chemical use of IGF-1 LR3 is concentrated in the bodybuilding and athletic performance community, typically at doses of 20-60 mcg SC once daily or post-workout. It is one of the most potent anabolic peptides available but also one of the highest-risk due to hypoglycemia (cross-reactivity at the insulin receptor), unintended peripheral tissue growth (IGF-1R is expressed on virtually every tissue in the body including the intestine, organs, and connective tissue), and theoretical cancer-promotion risk from sustained supraphysiologic mitogenic signaling. Users who choose IGF-1 LR3 should understand the risk profile differs fundamentally from GHRH/GHS peptides that work through the body's native pituitary axis.
Also known as: Pegylated Mechano Growth Factor, PEGylated IGF-1 Ec, MGF, Mechano Growth Factor, IGF-1 splice variant
PEG-MGF (Pegylated Mechano Growth Factor) is a synthetic, PEGylated form of Mechano Growth Factor (MGF) β an alternatively spliced variant of IGF-1 produced locally in muscle and other tissues in response to mechanical loading or damage. MGF differs from systemic IGF-1 in that it has a unique E-domain peptide (the Ec peptide, or MGF peptide) that activates satellite cells (muscle stem cells) rather than IGF-1 receptor signaling. Pegylation (attachment of polyethylene glycol chains) dramatically extends MGF's plasma half-life from minutes to approximately 24 hours, enabling systemic administration in research protocols. PEG-MGF is researched primarily for its muscle satellite cell activation, tissue repair, and recovery applications.
Also known as: AED
Cartalax is a short synthetic peptide developed in Russia by Vladimir Khavinson and colleagues at the St. Petersburg Institute of Bioregulation and Gerontology, positioned as a "cartilage bioregulator" intended to support chondrocyte function, cartilage matrix synthesis, and joint tissue resilience in age-related osteoarthritis, post-traumatic joint disease, and intervertebral disc degeneration. It is usually described in Khavinson-family publications as the tetrapeptide Ala-Glu-Asp-Leu (AEDL), sometimes written H-Ala-Glu-Asp-Leu-OH or A-E-D-L, though the literature also references slight sequence variants in early publications. Cartalax sits alongside Pinealon, Thymogen, Vilon, Epitalon, Livagen, Bronchogen, and Cardiogen within the Khavinson short-peptide bioregulator family, and is the defined-sequence counterpart to a polypeptide preparation called Sygumir (in some marketing) or cartilage-derived polypeptide complexes from Khavinson's original extract programme. Outside Russia, Cartalax is not registered as a drug, not reviewed by FDA, EMA, or PMDA, and not in any WADA category β though the WADA S0 non-approved substances clause arguably applies for competitive athletes. There are no phase II or phase III RCTs in PubMed or ClinicalTrials.gov, and Cartalax does not appear in OARSI, ACR, or EULAR osteoarthritis guidelines. Published Russian work comprises in vitro chondrocyte culture studies, rodent osteoarthritis model experiments, and small uncontrolled observational series in elderly patients with knee, hip, and spinal osteoarthritis (Khavinson et al., 2011; Chalisova et al., 2014; Anisimov et al., 2010). The central claim for Cartalax is the standard Khavinson short-peptide model applied to cartilage tissue: passive membrane permeation into chondrocytes, nuclear import, sequence-selective chromatin modulation, and preferential upregulation of chondrocyte survival, matrix synthesis (type II collagen, aggrecan, hyaluronic acid), and anti-catabolic programmes (downregulation of MMPs, ADAMTS). The tissue-specificity claim β that AEDL selectively targets cartilage rather than other connective tissue β is asserted but not supported by modern biodistribution, structural biology, or transcriptomics. The hypothesis is internally consistent within the Khavinson programme; it is substantially less validated than the pharmacology of evidence-graded osteoarthritis therapy. BodyHackGuide covers Cartalax because it is sold online in post-Soviet supplement channels (typically 20 mg oral capsules) and appears in longevity-stack discussions alongside joint-support adjuncts. We describe what is known, what is claimed, and what is missing β and we steer readers seeking evidence-graded joint and cartilage support toward interventions with better replication: weight management (single most impactful intervention for knee OA), structured exercise and physical therapy, NSAIDs where appropriate for symptomatic relief, intraarticular corticosteroid or hyaluronic acid injection, topical NSAIDs, Curcumin and Boswellia for modest anti-inflammatory benefit, collagen peptides and undenatured type II collagen (UC-II) with mixed but some positive evidence, BPC-157 and TB-500 as experimental peptide options with more mechanism data than Cartalax, and surgical intervention (arthroscopy, joint replacement) where indicated. Cartalax is a plausible hypothesis. It is not, in 2026, an evidence-graded cartilage therapy.
Also known as: EDR
Pinealon is a synthetic tripeptide β glutamyl-aspartyl-arginine (Glu-Asp-Arg, or EDR) β developed by the St Petersburg Institute of Bioregulation and Gerontology (IBG) under the leadership of Professor Vladimir Khavinson, the dominant figure in what is collectively known as the "Russian short-peptide bioregulator" school of research. Pinealon was designed as a peptide analog of signaling molecules found in natural extracts of the pineal gland, specifically a class of bioactive compounds that Khavinson's group began isolating and characterizing in the late 1980s as "cytomedins" β short peptides extracted from specific animal tissues and claimed to carry tissue-specific regulatory signals back to the corresponding tissue type. The Khavinson framework is as follows: the pineal gland, like other endocrine and parenchymal organs, contains short regulatory peptides that are involved in cell differentiation, gene expression regulation, and tissue homeostasis. When these natural peptides are purified, sequenced, and synthetic analogs are produced (the short-peptide analogs being the most studied), the synthetic peptides retain the ability to influence the same tissue from which they were derived. Pinealon, as the pineal-derived tripeptide bioregulator, is claimed to act on neural tissue β particularly the brain β to support neuroprotection, cognitive function, circadian regulation, and protection against age-related neurodegeneration. A substantial body of Russian-language clinical and preclinical literature supports these claims, going back to the 1990s and continuing through 2026. The work has been led by Khavinson and his collaborators at the Mechnikov North-Western State Medical University in St Petersburg, published in Russian medical journals (Uspekhi Gerontologii, Bulletin of Experimental Biology and Medicine) and selected Western journals (Neuroendocrinology Letters, Biogerontology). Outside Russia, Pinealon is part of a broader group of short-peptide bioregulators that includes Epitalon, Thymogen, Thymalin, Vilon, Livagen, and others β each claimed to be organ-specific based on the source tissue of the original natural peptide extract. The Western biomedical community has given Khavinson's work a mixed reception. On the positive side, the theoretical framework β that short peptides could function as tissue-specific gene-expression modulators β is scientifically coherent, and a subset of the claims (particularly around Epitalon and telomere biology) has attracted genuine interest and some independent replication. On the skeptical side, the clinical datasets are predominantly Russian, the independent replication of the most dramatic outcomes is thin, the peptides have never been through standard Western regulatory approval processes, and the commercial availability in Russia through the "Cytogen" brand (Cytomed) and various gerontology clinics has driven a significant body-hacking export market without corresponding Western clinical validation. This entry takes the honest position that Pinealon β and the broader Russian short-peptide bioregulator category β represents a plausible mechanism of action with real Russian clinical use, limited Western replication, and a research-grade user experience outside Russia. It is not FDA-approved, not widely available through Western prescription pharmacies, and carries the full research-chemical status in most Western jurisdictions. Users engaging with Pinealon are effectively trusting Khavinson's lab and its affiliated clinical collaborators, without the standard Western regulatory and replication infrastructure. For readers exploring the Khavinson peptide space, see also Epitalon, Thymogen, Cartalax, Vilon, and related entries. For comparison with other short-peptide neuroprotective compounds, see Cerebrolysin (a larger neuropeptide preparation), Semax (Russian ACTH-derived peptide), and Selank.
Also known as: Hepatic peptide
Livagen is a short synthetic peptide developed in Russia by Vladimir Khavinson and his collaborators at the St. Petersburg Institute of Bioregulation and Gerontology, positioned as a "liver bioregulator" intended to normalise age-related and stress-related changes in hepatic tissue. It is usually described in Khavinson-family publications as the tetrapeptide Lys-Glu-Asp-Ala (KEDA), sometimes written as H-Lys-Glu-Asp-Ala-OH or K-E-D-A, and is one of the shortest members of the large peptide-bioregulator family that also includes Epitalon (Ala-Glu-Asp-Gly), Pinealon (Glu-Asp-Arg), Vilon (Lys-Glu), and Thymogen (Glu-Trp). Within that framework, Livagen is the "sibling" peptide to a longer polypeptide preparation called Stamakort/Cortex peptide β which is a porcine liver extract β and is sold in the post-Soviet supplement channel as a dietary capsule alongside the other Khavinson tetrapeptides. Outside Russia and a small number of former-Soviet-state pharmacology journals, Livagen is not a registered drug, not a dietary ingredient reviewed by FDA, EMA or any major English-language regulator, and not a member of the WADA Prohibited List. There are no phase II or phase III randomised trials for Livagen indexed in PubMed or on ClinicalTrials.gov. The published Russian work β most of it co-authored by Khavinson and published in Bulletin of Experimental Biology and Medicine between 2002 and 2015 β describes in vitro chromatin effects and small rodent studies showing modulation of hepatic gene expression, hepatocyte proliferation markers, and restoration of age-related changes in liver morphology (Khavinson et al., 2003; Khavinson and Malinin, 2005; Anisimov et al., 2010). The central therapeutic claim Khavinson's group makes for Livagen is that the Lys-Glu-Asp-Ala tetrapeptide β small enough to cross plasma and nuclear membranes passively β can enter hepatocyte nuclei, interact with chromatin via sequence-selective contacts with histones and DNA, and preferentially activate transcription programmes that are normally suppressed by age and chronic stress. That model predicts selective reversal of age-related hepatic dysfunction without mitogenic or pro-inflammatory effects. The hypothesis is interesting and internally consistent within the Khavinson programme, but the molecular validation required by contemporary structural biology β co-crystal structures, ChIP-seq in hepatocyte models, chemically defined knock-out rescue β has not been published in Western-indexed literature. Readers should understand Livagen as an investigational Russian bioregulator with a sustained 25-year research programme inside one institute and minimal replication outside it. BodyHackGuide covers Livagen because it is frequently sold online β usually as 20 mg capsules containing roughly 2β4 mg of actual peptide per capsule β and because it appears in longevity-stack discussions alongside better-validated compounds. We describe what is known, what is claimed, and what is missing, and we steer readers who want evidence-graded hepatic support toward interventions with stronger replication: weight management, alcohol reduction, NAD+ precursors for mitochondrial support, Berberine and metformin for insulin-sensitising metabolic benefit in non-alcoholic fatty liver disease, and TUDCA (Tauroursodeoxycholic acid) for cholestatic biochemistry. Livagen is a plausible hypothesis. It is not, at this writing, an evidence-graded hepatic therapy.
Also known as: Cordyceps sinensis, Ophiocordyceps sinensis, Cordyceps militaris, Yarsagumba, Dong Chong Xia Cao, Caterpillar Fungus, Himalayan Gold, CS-4, Paecilomyces hepiali, Cordycepin, Dongchonghacho
Cordyceps is a genus of parasitic fungi (order Hypocreales, family Cordycipitaceae) historically prized in traditional Tibetan, Chinese, and Bhutanese medicine for their purported abilities to restore vitality, improve athletic performance, support respiratory and kidney function, and promote longevity. The two species of greatest pharmacological interest are Ophiocordyceps sinensis (formerly Cordyceps sinensis, reclassified in 2007), the wild "caterpillar fungus" that grows on the larvae of ghost moths (Thitarodes species) in the alpine meadows of the Tibetan plateau, Nepal, and Bhutan at elevations of 3,000-5,000 meters; and Cordyceps militaris, a more readily cultivated species that grows on a variety of insect hosts and is now farmed commercially on rice or silkworm pupae substrate. Wild O. sinensis is known in Tibetan as yartsa gunbu ("summer grass winter worm"), in Chinese as dong chong xia cao (ΟΓ₯ΒΌΞ¦ΖβΟñà Φìë, literally "winter-worm summer-grass"), in Nepali as yarsagumba, and in Bhutanese as yartsa gunbu β reflecting the organism's notable life cycle in which the fungus infects a moth larva over winter, mummifies it, then in spring emerges as a club-shaped fruiting body from the caterpillar's head. The mummified caterpillar-plus-fungus complex is the traditional medicinal preparation, sometimes selling for US$20,000-$50,000 per kilogram in premium Chinese markets, making wild O. sinensis one of the most expensive natural products in the world β gram-for-gram more valuable than gold in certain grades. Commercial cultivation of O. sinensis has been historically impossible because the fungus requires specific temperature, altitude, and host-insect conditions that are extraordinarily difficult to replicate in vitro. The supplement industry has responded in two ways: (1) cultivation of Cordyceps militaris, a related species that grows readily on grain substrates and produces many of the same bioactive compounds (particularly cordycepin and adenosine) β often at higher concentrations than wild O. sinensis; and (2) cultivation of Paecilomyces hepiali (marketed as "Cs-4" or "CordyMax"), an anamorphic fungal strain isolated from wild O. sinensis that can be grown by submerged fermentation. Cs-4 is technically a different organism from wild O. sinensis but retains similar bioactive profiles and has been the subject of most of the human clinical research on "Cordyceps" over the past 40 years. Consumers should understand that virtually no commercial "Cordyceps sinensis" supplement contains wild caterpillar fungus β what they are buying is either C. militaris, Cs-4/P. hepiali, or mycelium-on-grain preparations with variable active compound content. The principal bioactive compounds in Cordyceps species include cordycepin (3'-deoxyadenosine, an adenosine analog with anti-tumor, anti-viral, and immunomodulatory activity), adenosine (a purine nucleoside with cardiovascular and neurological effects), Ξ²-glucans and polysaccharides (immunomodulatory), ergosterol (vitamin D2 precursor), mannitol (cordycepic acid), various nucleosides, and smaller amounts of ergothioneine. Cordyceps militaris typically contains higher cordycepin content than O. sinensis, while O. sinensis contains higher levels of certain polysaccharides. Cordycepin is particularly important pharmacologically because it is structurally identical to adenosine except for the lack of a 3'-hydroxyl group on the ribose sugar β this subtle difference allows cordycepin to incorporate into RNA and disrupt polyadenylation, mRNA stability, and certain kinase signaling pathways, underlying many of its anti-cancer and anti-inflammatory effects. The claimed benefits of Cordyceps span several domains: (1) exercise performance and VO2max β probably the best-studied indication in Western research, anchored on early attention generated by the 1993 Chinese National Games when Chinese women distance runners (including Wang Junxia, who set the 10,000m world record) dramatically improved performance while taking Cordyceps and turtle blood preparations. Subsequent randomized controlled trials have tested whether supplementation improves VO2max, time-to-exhaustion, and exercise tolerance, with generally positive but modest results (Chen 2010, Hirsch 2017 discussed below). (2) Immune support and respiratory health β traditional use for asthma, chronic bronchitis, and COPD, with some modern evidence of bronchodilatory and anti-inflammatory effects. (3) Energy/fatigue β as an adaptogen, with mechanistic rationale in ATP production and mitochondrial function. (4) Kidney function β extensively used in traditional Chinese medicine for "kidney yang deficiency"; modern studies in chronic kidney disease and diabetic nephropathy show some benefit. (5) Libido and sexual function β traditional aphrodisiac with weak modern evidence. (6) Anti-aging/longevity β the most speculative indication, with animal data showing lifespan extension in some models. (7) Blood sugar regulation β some evidence in type 2 diabetes animal models and small clinical trials. The strongest human clinical evidence exists for exercise performance in older adults and for Cs-4 in renal disease. The Chen et al. 2010 trial (Journal of Alternative and Complementary Medicine, PMID: 20804368) is frequently cited: a 12-week randomized, double-blind, placebo-controlled trial of CS-4 (Cs-4/P. hepiali) 3 grams/day in 20 healthy older adults (mean age 64). The Cs-4 group showed statistically significant improvements in metabolic threshold (the exercise intensity above which lactate accumulates) and ventilatory threshold compared with placebo, without changes in VO2max or peak exercise capacity. This suggests Cs-4 may improve exercise tolerance at sub-maximal intensities β the intensities most relevant to everyday function in older adults β more than maximal capacity. The Hirsch et al. 2017 trial in Journal of Dietary Supplements (PMID: 27621906) tested Cordyceps militaris (PeakO2, 4g/day) in younger recreationally active adults over 3 weeks and found improvements in time-to-exhaustion and VO2max. While these are small trials, they provide a plausibility basis for the exercise performance claim. For chronic kidney disease, a growing body of Chinese research β and a 2014 Cochrane systematic review (Zhang et al., PMID 25519363) β has examined Cs-4 and similar Cordyceps preparations as adjunctive therapy alongside standard care. The review analyzed 22 trials with 1,746 participants and concluded that Cordyceps adjunctive therapy may reduce serum creatinine, increase creatinine clearance, reduce proteinuria, and improve hemoglobin in CKD patients, though the authors cautioned about methodological limitations in the included trials (many were Chinese-language only, with unclear blinding and randomization procedures). This has led some integrative nephrologists to consider Cordyceps as an adjunct in CKD management, particularly in regions where it is culturally accepted. Where Cordyceps fits honestly in the supplement landscape: it is best positioned as a general adaptogen and exercise-support supplement for recreationally active adults, older adults seeking support for functional capacity, and as a low-risk adjunctive option for individuals with CKD (under medical supervision) or respiratory conditions. It is NOT a substitute for proven exercise training programs, cardiopulmonary rehabilitation, or evidence-based treatments for kidney disease (ACE inhibitors, SGLT2 inhibitors, diet, blood pressure control). It sits honestly alongside Rhodiola for fatigue, Panax ginseng for physical performance, and Lion's Mane for cognitive support as one of the mushroom-and-root adaptogens with modest but real clinical evidence. Safety is generally excellent with cultivated preparations. Wild O. sinensis carries contamination risks (arsenic, lead from the Tibetan soil environment) and has been associated with rare cases of lead poisoning when adulterated with metal powders to increase weight and price. Cultivated C. militaris and Cs-4 have demonstrated good safety profiles in clinical trials at doses up to 3-4 grams/day for 12 weeks. Interactions with anticoagulants (theoretical, based on some in vitro antiplatelet effects), immunosuppressants (theoretical immune activation), and diabetes medications (possible additive hypoglycemic effect) warrant caution in those populations.
Get Recovery & Healing research updates
Protocols, price drops, and new compounds for recovery & healing.
No spam. Unsubscribe anytime.
Need help building a recovery & healing stack?
Get personalized coaching from an experienced biohacker.






