2026 Buyer's Guide
Best Peptides for Recovery & Healing — 2026
Top-ranked peptides for recovery & healing based on research evidence and current vendor availability. Each compound below links to its full research profile, live vendor pricing, and active coupon codes. Peptides and compounds studied for tissue repair, healing, and regeneration.
Top 18 peptides for recovery & healing
BPC-157
Injury, Repair & Recovery Top pickBPC-157 (Body Protection Compound-157) is a synthetic pentadecapeptide consisting of 15 amino acids (Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val) derived from a partial sequence of human gastric juice protein BPC. It has a molecular weight of 1419.53 Da and a CAS …
TB-500 (Thymosin Beta-4)
Injury, Repair & RecoveryTB-500 is a synthetic peptide fragment of thymosin beta-4 (Tbeta4), a 43-amino-acid protein that is one of the most abundant intracellular actin-sequestering molecules in mammalian cells. With a molecular weight of approximately 4963 Da, TB-500 encompasses the active region of th…
GHK-Cu
Skin, Hair & AestheticsGHK-Cu is the copper(II) complex of the tripeptide glycyl-L-histidyl-L-lysine, a molecule Pickart and Thaler first pulled out of human plasma in 1973. The free peptide (GHK, C14H24N6O4) weighs about 340.4 Da; bind it 1:1 to copper and you get the neutral GHK-Cu complex (C14H22CuN…
KPV
RecoveryKPV is a three-amino-acid peptide — Lysine-Proline-Valine — that makes up the C-terminal tail of alpha-MSH (alpha-melanocyte-stimulating hormone). With a molecular weight of only 342.4 Da, it is one of the smallest peptides in the research space, yet it preserves much of the anti…
PDRN
Skin & HairPDRN (Polydeoxyribonucleotide) is a biotechnological compound derived from salmon sperm DNA (Oncorhynchus mykiss) through extraction, purification, and fractionation. It consists of polynucleotide chains with molecular weights ranging from 50 to 1500 kDa. PDRN is widely used in A…
Thymosin Alpha-1 (TA1)
Immune & InflammationThymosin alpha-1 (Tα1) is a 28-amino-acid N-acetylated peptide (N-Ac-Ser-Asp-Ala-Ala-Val-Asp-Thr-Ser-Ser-Glu-Ile-Thr-Thr-Lys-Asp-Leu-Lys-Glu-Lys-Lys-Glu-Val-Val-Glu-Glu-Ala-Glu-Asn) isolated and characterized by Allan Goldstein's laboratory at George Washington University in the …
Thymalin
PeptidesThymalin is a thymus-derived peptide complex developed in the 1970s by Vladimir Khavinson and the Leningrad (now St. Petersburg) Institute of Bioregulation and Gerontology as part of a broader program to identify tissue-specific regulatory peptides from mammalian organs. Produced…
LL-37
Immune & InflammationLL-37 is the only human cathelicidin, a 37-amino-acid amphipathic alpha-helical peptide ([LL-37, 37 aa]) cleaved from the C-terminus of the 170-amino-acid precursor hCAP-18 (human cationic antimicrobial protein, 18 kDa), which is encoded by the CAMP gene on…
Humanin
RecoveryHumanin is a 24-amino-acid peptide (MAPRGFSCLLLLTSEIDLPVKRRA) encoded within the mitochondrial 16S ribosomal RNA gene and translated from a short open reading frame that was not recognized as biologically active until 2001, when Hashimoto and colleagues identified it in a screen …
ARA-290
RecoveryARA-290, also known as Cibinetide or pHBSP (Helix B Surface Peptide), is an 11-amino-acid peptide — QEQLERALNSS — designed to mimic a specific region of the tissue-protective surface of erythropoietin (EPO) without activating the classical hematopoietic EPO receptor that drives r…
IGF-1 LR3
Growth Hormone / IGF-1 AxisIGF-1 LR3 (Long R3 IGF-1) is a synthetic analog of human insulin-like growth factor 1 modified at two positions to dramatically extend its serum half-life and amplify its tissue bioactivity compared to native IGF-1. The "LR3" designation describes the two key modifications: - **…
PEG-MGF
PerformancePEG-MGF (Pegylated Mechano Growth Factor) is a synthetic, PEGylated form of Mechano Growth Factor (MGF) — an alternatively spliced variant of IGF-1 produced locally in muscle and other tissues in response to mechanical loading or damage. MGF differs from systemic IGF-1 in that it…
Cartalax
RecoveryCartalax is a short synthetic peptide developed in Russia by Vladimir Khavinson and colleagues at the St. Petersburg Institute of Bioregulation and Gerontology, positioned as a "cartilage bioregulator" intended to support chondrocyte function, cartilage matrix synthesis, and joi…
Pinealon
NootropicsPinealon is a **synthetic tripeptide — glutamyl-aspartyl-arginine (Glu-Asp-Arg, or EDR)** — developed by the St Petersburg Institute of Bioregulation and Gerontology (IBG) under the leadership of **Professor Vladimir Khavinson**, the dominant figure in what is collectively known …
Cordyceps
Adaptogen**Cordyceps** is a genus of parasitic fungi (order Hypocreales, family Cordycipitaceae) historically prized in traditional Tibetan, Chinese, and Bhutanese medicine for their purported abilities to restore vitality, improve athletic performance, support respiratory and kidney func…
Recovery & Healing hub
Browse every compound tagged for recovery & healing, including stack ideas.
Compare prices
Real-time vendor pricing across every tracked research compound.
Trust Score rubric
The 0-100 vendor scoring system used to filter every link on this page.
Best peptides for recovery & healing — FAQ
What are the best peptides for recovery & healing?
The top-ranked peptides for recovery & healing based on research evidence and current vendor pricing are: 1) BPC-157, 2) TB-500 (Thymosin Beta-4), 3) BPC-157/TB-500 Blend, 4) GHK-Cu, 5) KPV. Each is profiled below with mechanism, dosing, and the cheapest current source.
Which peptide works fastest for recovery & healing?
Onset varies by mechanism. Direct-acting compounds (e.g., metabolic agonists for fat loss, healing peptides for tissue repair) typically show effects within 2-4 weeks of consistent dosing. Adaptogenic and longevity compounds operate on slower 8-12 week timelines. Each compound profile has its own onset notes — see the linked research pages for specifics.
Where to buy peptides for recovery & healing?
BodyHackGuide tracks live vendor pricing across every compound on this page. Each row links to the buyer-intent /buy/<compound> page where vendors are ranked cheapest-first by price per mg, with active coupon codes surfaced. Trust Score rubric (0-100) filters out low-quality vendors before they're surfaced anywhere.
Are these peptides legal to buy?
All compounds linked here are sold by vendors for research-use-only — no prescription required for research purchases. None of the vendors on BodyHackGuide sell research compounds for human consumption. BodyHackGuide editorial doesn't promote off-label use; we provide research data so qualified researchers can make informed sourcing decisions.
Affiliate disclosure. BodyHackGuide may earn a commission from purchases via links on this page — at no additional cost to you. Compound rankings are based on research-evidence strength and live vendor data; we don't accept payment for editorial placement. See our full affiliate disclosure .