Skip to content

    Research Use Only

    This site is an educational resource for research compounds. We do not endorse human consumption of any compound. BodyHackGuide and BHG Labs share common ownership; we rank every vendor on the same public methodology, and we earn a commission on purchases through our links. By entering, you confirm you are 21 years of age or older and agree to our Terms & Privacy Policy.

    100K+ researchers trust BodyHackGuide — Join r/BodyHackGuide
    R

    Best price right now

    $6.50/mg· $64.99 for 10mg at ResearchChemHQ

    Across 5 verified vendors

    Tesamorelin molecular structure

    Tesamorelin

    Growth Hormone / IGF-1 AxisFDA Approved

    Also known as: Tesa, TH9507

    Tesamorelin is a stabilized synthetic analog of human growth hormone-releasing hormone (GHRH) — specifically the full 44-amino-acid GHRH sequence with a single N-terminal trans-3-hexenoyl fatty-acid modification. That modification protects the peptide from rapid dipeptidyl peptidase-4 (DPP-4) degradation, extending its circulating half-life to approximately 30 minutes (vs <2 minutes for native GHRH). Tesamorelin was developed by Theratechnologies and is marketed in the US as Egrifta (branded injectable) and Egrifta SV (updated formulation launched 2019).

    Half-Life: 30-50 minutes (plasma)Route: subcutaneousMW: 5135.9 DaCAS: 218949-48-58 PubMed Studies
    Last reviewed:

    Overview

    Best Price Available

    ⚗️

    ResearchChemHQ

    $64.99

    1 vial · vial

    Coupon:REDDIT

    At A Glance

    Mechanism

    Tesamorelin activates the same GHRH receptor (GHRHR) as endogenous GHRH and CJC-1295 / MOD-GRF 1-29, but with a distinct pharmacokinetic profile driven by its trans-3-hexenoyl N-terminal modification.

    Half-Life
    30-50 minutes (plasma)
    Dosing
    Once daily subcutaneous injection
    Dose Range
    1,000–2,000 mcg (1–2 mg) dailymcg
    Routes
    subcutaneous
    Common Vials
    2mgmg10mgmg
    Potential Benefits
    Reduction of visceral adipose tissue (~15% at 26 weeks in the pivotal HIV trial; FDA-label indication)Reduction of hepatic fat content (NAFLD off-label indication)Elevated IGF-1 within the age-adjusted reference rangePreserved pulsatile GH release (vs continuous elevation with CJC-1295-DAC)Improved body composition (VAT down, lean mass preserved)Sustained VAT reduction through 52 weeks with continued dosingFDA-approved - the only GHRH secretagogue with that status
    Safety Notes
    Common
    Injection site reactionsFluid retentionArthralgiasMyalgias

    Mechanism of Action

    Tesamorelin activates the same GHRH receptor (GHRHR) as endogenous GHRH and CJC-1295 / MOD-GRF 1-29, but with a distinct pharmacokinetic profile driven by its trans-3-hexenoyl N-terminal modification.

    1. GHRH receptor agonism (Gs / cAMP / PKA / CREB pathway)

    • Tesamorelin binds GHRHR - a Class B1 GPCR on anterior pituitary somatotrophs
    • Receptor activation engages Gs, elevating intracellular cAMP
    • cAMP activates PKA, which phosphorylates CREB
    • Phospho-CREB upregulates GH-1 gene transcription and mobilizes preformed GH from secretory granules
    • Net effect: GH pulse within 15-30 min of injection, peaking around 60 min

    Tesamorelin has full agonist activity at GHRHR with receptor binding affinity comparable to native GHRH and significantly higher potency than native GHRH due to its longer plasma presence ([Ferdinandi et al., 2007]).

    2. Preserved pulsatile GH release (key differentiator from CJC-1295-DAC)

    Tesamorelin has a plasma half-life of ~30-50 minutes - short enough to clear between physiologic GH pulses while long enough to provide dose-response amplification of endogenous pulses. This preserves:

    • Somatotroph sensitivity - continuous GHRH exposure (as with CJC-1295 with DAC's ~8-day half-life) desensitizes pituitary receptors; tesamorelin's pulsatile exposure does not
    • Somatostatin-mediated negative feedback - between tesamorelin pulses, somatostatin can appropriately suppress GH, preventing supra-physiologic elevation
    • Circadian integration - the daily pre-bed dose amplifies rather than replaces the nocturnal GH burst

    This pulsatile-exposure profile is the mechanistic rationale for why tesamorelin was developable as an approved drug where continuous-release GHRH analogs such as CJC-1295-DAC were not.

    3. Downstream IGF-1 elevation

    Acute GH pulses hepatic IGF-1 synthesis, peaking ~24h post-dose. In the key Phase 3 trial, tesamorelin 2 mg daily raised mean IGF-1 by approximately 81% from baseline at week 26 - into the upper end of the age-adjusted reference range for most adults ([Falutz et al., 2007]).

    IGF-1 drives the downstream metabolic effects:

    • Lipolysis in visceral adipose tissue (preferentially) VAT reduction
    • Hepatic triglyceride mobilization decreased hepatic steatosis
    • Muscle protein synthesis lean body mass preservation
    • Connective tissue anabolism accelerated repair

    4. Preferential visceral fat mobilization

    Tesamorelin's most clinically distinctive effect is its preferential reduction of visceral adipose tissue over subcutaneous fat. In the pivotal trial, VAT decreased ~15% at 26 weeks while subcutaneous abdominal fat was largely unchanged ([Falutz et al., 2007]). This selectivity is driven by:

    • Higher -adrenergic receptor density on visceral adipocytes vs subcutaneous
    • Greater sensitivity of visceral fat to GH-mediated lipolysis
    • Portal delivery of visceral-origin FFAs to the liver, which the GH pulse mobilizes for oxidation

    5. Secondary effects beyond the GH axis

    • Hepatic fat reduction - independent of weight loss; mediated by GH-driven hepatic lipid export ([Stanley et al., 2014])
    • Cognitive effects - a phase 2 randomized trial in people with HIV and abdominal obesity raised IGF-1 and reduced waist circumference but found no significant between-group improvement in neurocognitive performance versus standard of care ([Ellis et al., 2025])
    • Potential modest HDL elevation and triglyceride reduction - secondary lipid changes observed in the pivotal and extension trials

    Overview

    Tesamorelin is a stabilized synthetic analog of human growth hormone-releasing hormone (GHRH) — specifically the full 44-amino-acid GHRH sequence with a single N-terminal trans-3-hexenoyl fatty-acid modification. That modification protects the peptide from rapid dipeptidyl peptidase-4 (DPP-4) degradation, extending its circulating half-life to approximately 30 minutes (vs <2 minutes for native GHRH).

    Tesamorelin was developed by Theratechnologies and is marketed in the US as Egrifta (branded injectable) and Egrifta SV (updated formulation launched 2019). It is the only FDA-approved GHRH secretagogue in the United States, approved in 2010 for the reduction of excess abdominal fat in HIV-infected patients with lipodystrophy. The approval was based on two Phase 3 trials showing ~18% reduction in visceral adipose tissue (VAT) at 26 weeks and sustained effect through 52 weeks ([Falutz et al., 2007]; [Falutz et al., 2010]).

    Unlike CJC-1295 with DAC, tesamorelin produces a pulsatile rather than sustained GH elevation. It preserves the negative-feedback regulation of the somatotroph axis because its half-life is short enough to clear between pulses, and this is the primary clinical reason it was developable as a long-term therapy where CJC-1295-DAC's continuous GH elevation raised safety concerns.

    Beyond the FDA-approved HIV lipodystrophy indication, tesamorelin is being studied and used off-label for:

    • Non-alcoholic fatty liver disease (NAFLD / NASH) — Phase 2 trial showed reductions in hepatic fat fraction and liver enzymes ([Stanley et al., 2014])
    • HIV-associated cognitive decline — pilot data on executive function and memory ([Adrian et al., 2018])
    • General visceral adiposity in non-HIV metabolically-unhealthy adults (off-label biohacker use)
    • Adjunct to CJC-1295 / MOD-GRF 1-29 + Ipamorelin stacks — when GHRH-only amplification is desired without the pulsatility trade-off of CJC-1295 with DAC

    Typical dosing: 2 mg subcutaneous once daily pre-bed (matches the FDA-approved protocol). Dose escalation above 2 mg/day has been studied but does not produce proportional IGF-1 elevation and raises fluid-retention burden.

    Regulatory status: FDA-approved for HIV lipodystrophy; available by prescription in the US. Biohacker use is off-label and typically sourced through compounding pharmacies or (controversially) research-chemical vendors. See our Tesamorelin Dosage Guide for protocol specifics.

    Potential Research Fields

    HIV-associated lipodystrophyVisceral adiposityCognitive agingMetabolic syndrome

    Chemical Information

    IUPAC Name

    trans-3-hexenoyl-GHRH(1-44)amide

    CAS Number

    218949-48-5

    Molecular Formula

    C221H366N72O67S

    Molecular Mass

    5135.8 g/mol

    Amino Acid Sequence

    trans-3-hexenoyl-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu-NH2 (single-letter: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL). Tesamorelin is human GHRH(1-44) bearing an N-terminal trans-3-hexenoyl group on Tyr1 and a C-terminal amide. Molecular formula C221H366N72O67S; molecular weight ~5135.9 Da.

    Dosing & Protocols

    Unlock Dosing Protocols

    Free account gets you:

    • View beginner, intermediate & advanced protocols
    • See weight-based dosing calculations
    • Access cycle length & frequency data

    2,800+ researchers already in

    Research

    Unlock Research Data

    Free account gets you:

    • Browse PubMed study summaries
    • See clinical trial phases & results
    • Access mechanism of action details

    2,800+ researchers already in

    Interactions

    Interaction Matrix

    Contraindications

    Absolute contraindications (per FDA label)

    • Disruption of the hypothalamic-pituitary axis — pituitary tumor or removal, hypopituitarism, hypothalamic injury. Tesamorelin requires an intact pituitary to work and can potentially accelerate residual tumor growth
    • Active malignancy — GH/IGF-1 axis may accelerate tumor growth. Absolute contraindication during active cancer treatment or within 5 years of complete remission
    • Pregnancy — category X; do not use
    • Active proliferative or severe non-proliferative diabetic retinopathy — GH elevation can worsen retinopathy
    • Known hypersensitivity to tesamorelin or mannitol (excipient in commercial formulation)

    Additional off-label biohacking contraindications

    • Uncontrolled T2DM — tesamorelin acutely impairs glucose tolerance; should be optimized before starting
    • Active diabetic retinopathy (any grade) — even non-proliferative
    • History of acromegaly or pituitary adenoma — absolute
    • Severe heart failure (NYHA III-IV) — fluid retention can precipitate decompensation
    • Acute critical illness — tesamorelin is not safe during severe acute illness (sepsis, post-surgical critical care); this mirrors recombinant GH warnings

    Relative contraindications (consult physician before use)

    • Type 2 diabetes or pre-diabetes — use with monitoring; expect HbA1c elevation of ~0.1-0.3 points
    • Uncontrolled hypertension — fluid retention can exacerbate blood pressure
    • History of carpal tunnel syndrome — fluid retention can reactivate symptoms
    • Hypothyroidism — thyroid status affects GH axis; optimize thyroid first
    • Age >70 — limited efficacy data; safety data from HIV trials does not include most elderly populations

    Drug interactions

    • Glucocorticoids (chronic systemic) — suppress GH axis and blunt tesamorelin efficacy
    • Insulin and oral hypoglycemics — tesamorelin's effect on glucose tolerance may require dose adjustments
    • CYP3A4 substrates — tesamorelin is not a CYP3A4 inhibitor or inducer; minimal interactions
    • Exogenous recombinant GH — do not combine; redundant
    • Other GHRH analogs — do not use simultaneously at the same receptor

    Monitoring requirements

    • Baseline: IGF-1, fasting glucose, HbA1c, complete metabolic panel, thyroid (TSH, free T4), PSA (men >40), CBC, lipid panel
    • Week 4-6: IGF-1 (target: within age-adjusted reference range, typically <250 ng/mL for adults 30-50)
    • Every 12 weeks on therapy: IGF-1, HbA1c, fasting glucose
    • Annually: Full panel + reassess need for continued therapy

    Discontinuation criteria

    Stop tesamorelin and consult a clinician if you develop:

    • IGF-1 > age-adjusted upper limit
    • HbA1c rising >0.4 points within one cycle
    • Persistent peripheral edema or new carpal tunnel symptoms
    • Any new palpable mass, changing mole, or unexplained weight loss (cancer workup indicated)
    • Severe headache, visual changes (rule out pituitary pathology)
    • Signs of fluid overload or CHF decompensation

    Research Disclaimer

    This interaction data is compiled from published research and community reports. It may not be exhaustive. Always consult a healthcare professional before combining compounds.

    Best Price

    $44.99

    up to $84.99

    Best $/mg

    $5.9990

    Vendors

    5

    Listings

    7

    vial

    Dosage
    Form
    Sort
    Vendor Product Form Qty Price $/mg Coupon
    ResearchChemHQ logo
    ResearchChemHQ
    100
    🇺🇸US
    RC-Tesamorelin 10mg vial 1 vial● In Stock $64.99BEST $6.499
    BHG Labs logo
    BHG Labs
    70
    🇺🇸US
    BHG-2T 10mg (Tesamorelin) vial 1 vial● In Stock $84.99 $8.499
    Optimum Formula logo
    Optimum Formula
    100
    🇺🇸US
    Tesamorelin 10mg vial 1 vial● In Stock $69.99 $6.999
    BioMyst Labs logo
    BioMyst Labs
    70
    🇺🇸US🌍International
    Tesamorelin 10mg vial 1 vial● In Stock $59.99 $5.999
    BioMyst Labs logo
    BioMyst Labs
    70
    🇺🇸US🌍International
    Tesamorelin 10mg vial 1 vial● In Stock $69.99 $6.999
    VANDL Labs logo
    VANDL Labs
    50
    🇺🇸US
    Tesamorelin 2mg vial 2mg vial● In Stock $44.99 $22.495
    VANDL Labs logo
    VANDL Labs
    50
    🇺🇸US
    Tesamorelin 5mg vial 5mg vial● In Stock $69.99 $13.998

    Get Tesamorelin Price Drop Alerts

    Set a target price and we'll notify you when any vendor drops below it. Current lowest: $44.99

    Sign in to leave a review

    Reviews on BodyHackGuide are tied to verified user accounts and moderated before publishing. Sign in (free, no spam) to share your experience with Tesamorelin.

    Current low
    $84.99
    as of Jul 1, 2026
    7-day low
    no 7d data yet
    30-day low
    no 30d data yet
    30-day change
    baseline building

    Tracking since Mar 13, 2026 · 10 data points

    Price History

    5 data points

    Vendors Selling Tesamorelin

    How we score these vendors

    Every supplier above is graded 0–100 on COA verification, payment transparency, shipping, reviews, and active listings. Methodology published, no pay-to-rank.

    View Scorecard

    Related Compounds

    View All

    CJC-1295 (Mod GRF 1-29)

    Growth Hormone / IGF-1 AxisPreclinical

    CJC-1295 without DAC (also called Modified GRF 1-29 or MOD-GRF 1-29) is a 30-amino-acid analog of the first 29 residues of endogenous Growth Hormone Releasing Hormone (GHRH), with four strategic substitutions (D-Ala² for DPP-4 resistance, Gln⁸, Ala¹⁵, Leu²⁷) that extend its plasma half-life from <2 minutes (native GHRH) to ~30 minutes.

    t½ ~30 minutes (without DAC / MOD-GRF 1-29); ~6-8 days (with DAC, due to covalent albumin binding) Without DAC: 100-300 mcg subcutaneous 1-3x daily (typically pre-bedtime); With DAC: 1000-2000 mcg subcutaneous once weekly
    29 studiesView Profile

    CJC-1295 with DAC

    Growth Hormone / IGF-1 AxisPhase 2

    CJC-1295 with DAC (Drug Affinity Complex) is a modified form of CJC-1295 that incorporates a maleimidopropionic acid (MPA) reactive group at the C-terminus.

    t½ 6–8 days (due to albumin binding via DAC) 1,000–2,000 mcg (1–2 mg) per injection
    PreclinicalView Profile

    CJC-1295 with DAC

    Growth Hormone / IGF-1 AxisPreclinical / Research peptide

    CJC-1295 with DAC is the long-acting variant of CJC-1295.

    t½ ~6-8 days (DAC-bound albumin depot) 1000-2000 mcg (1-2 mg) per week
    PreclinicalView Profile

    GHRP-2

    Growth Hormone / IGF-1 AxisPhase 2

    GHRP-2 (growth hormone-releasing peptide-2), also known as pralmorelin and KP-102, is a synthetic hexapeptide growth hormone secretagogue that was among the first GHRPs developed in the seminal research of Cyril Bowers and colleagues at Tulane University in the late 1980s and early 1990s.

    t½ ~15-30 minutes 100–300 mcg per injection
    212 studiesView Profile

    GHRP-6

    Growth Hormone / IGF-1 AxisPhase 2

    GHRP-6 (growth hormone-releasing peptide-6) is a synthetic hexapeptide with the sequence His-D-Trp-Ala-Trp-D-Phe-Lys-NH2 that binds the ghrelin receptor (GHS-R1a) to stimulate endogenous growth hormone release.

    t½ ~20–30 minutes 100–300 mcg per injection
    156 studiesView Profile

    Hexarelin

    Growth Hormone / IGF-1 AxisPhase 2

    Hexarelin (also called examorelin) is a potent synthetic hexapeptide growth hormone secretagogue with the sequence His-D-2-methyl-Trp-Ala-Trp-D-Phe-Lys-NH2.

    t½ ~55 minutes (IV, per Imbimbo 1994) 100–200 mcg per injection
    14 studiesView Profile

    View Full Dosage Guide →

    Protocols, calculator & safety for Tesamorelin

    Related Articles

    All Posts

    Tesamorelin: A Complete Research Reference

    Tesamorelin is a synthetic, stabilized GHRH analog approved as Egrifta for HIV-associated visceral fat. This guide covers the real trial evidence for visceral fat, liver fat, and cognition, how it differs from CJC-1295 and from GH itself, the approved and studied doses, and how the peptide-research community discusses it, with research-use-only framing throughout.

    7/1/2026

    Aquasome Nanotechnology and Oral Peptides: The Mechanism, the Research, and the 10 Compounds It Actually Works For

    how aquasome 3-layer nano-encapsulation lets peptides like retatrutide, bpc-157, and tb-500 survive the gut. pubmed-backed deep dive on the 10 compounds it works for.

    5/20/2026

    Retatrutide Protocol Guide: What the Phase 2 Trial Actually Showed

    An education-first walkthrough of retatrutide (LY3437943), the triple GLP-1/GIP/glucagon agonist. Covers the Phase 2 NEJM trial data at 24 and 48 weeks, the trial titration schedule, side effects, reconstitution, and honest sourcing. Research-use-only, not FDA-approved, not medical advice.

    5/19/2026

    Best Price

    ⚗️

    ResearchChemHQ

    $64.99

    5 vendors · 7 listings

    Research Score

    61

    8 PubMed studies

    Quality Indicators

    Data Completeness

    100%
    Description
    Mechanism of Action
    Chemical Data
    Dosing Protocols
    Safety Profile
    PubMed Studies
    Interactions
    Vendor Listings

    COA Verification

    10

    Verified COAs

    2

    Vendors w/ COA

    High verification rate (83%)

    Latest test: 3/1/2026

    Research Credibility

    8PubMed studies

    Limited research available

    Quick Facts

    Half-Life

    30-50 minutes (plasma)

    Molecular Weight

    5135.8 g/mol

    Administration

    subcutaneous

    CAS Number

    218949-48-5

    Trial Phase

    FDA Approved

    Safety Profile

    Low Risk

    Common Side Effects

    • Injection site reactions
    • Fluid retention
    • Arthralgias
    • Myalgias

    Stop Use If

    • Active malignancy
    • Pregnancy
    • Pituitary surgery or radiation history
    • Acute illness

    Research Disclaimer

    This information is for educational and research purposes only. Not intended as medical advice. Consult a healthcare professional before use.

    Frequently Asked Questions

    What is tesamorelin and what is it FDA-approved for?

    Tesamorelin is a stabilized synthetic analog of human growth hormone-releasing hormone (GHRH) - specifically the full 44-amino-acid sequence with a trans-3-hexenoyl N-terminal modification that extends its plasma half-life to ~30-50 minutes. It is FDA-approved (2010) for the reduction of excess abdominal fat in HIV-infected patients with lipodystrophy and is marketed as Egrifta / Egrifta SV by Theratechnologies. It is the only FDA-approved GHRH secretagogue in the United States. Approval was based on two Phase 3 trials showing ~15-18% reduction in visceral adipose tissue (VAT) at 26 weeks (Falutz et al., 2007).

    How is tesamorelin different from CJC-1295 with DAC?

    Both activate the GHRH receptor (GHRHR), but their pharmacokinetics are fundamentally different. Tesamorelin has a 30-50 minute half-life - short enough to clear between physiologic GH pulses, preserving the pulsatile architecture and somatostatin-mediated negative feedback. CJC-1295 with DAC has a ~8-day half-life due to albumin-binding, producing continuous, non-pulsatile GH elevation. The continuous elevation of CJC-1295-DAC drives long-term safety concerns (somatotroph desensitization, supra-physiologic IGF-1, theoretical acromegalic progression) that tesamorelin avoids. This is the primary mechanistic reason tesamorelin was developable as an FDA-approved drug where CJC-1295 with DAC was not.

    What's the correct dose and how often should I inject tesamorelin?

    The FDA-approved dose is 2 mg subcutaneous, once daily, pre-bed, fasted. This is the dose used in all Phase 3 trials and is the standard for both the HIV lipodystrophy label indication and off-label biohacker use. Dose escalation above 2 mg/day has been studied (up to 4 mg) and does not produce proportional IGF-1 elevation - the dose-response plateaus while side-effect burden rises. The fasted state is essential: post-meal dosing blunts the GH pulse by 50-70%. Pre-bed timing leverages the body's largest natural GH pulse (the nocturnal burst).

    Is tesamorelin safer than injecting actual growth hormone (somatropin)?

    Mechanistically, yes. Tesamorelin amplifies the body's own pulsatile GH release through the pituitary, preserving negative feedback and physiologic pulse architecture. Exogenous somatropin bypasses the pituitary, produces tonic non-pulsatile GH elevation, and carries an FDA black-box warning for critical-illness mortality. Tesamorelin has no black-box warning. However, both share the GH/IGF-1 safety envelope - active malignancy, diabetic retinopathy, and pituitary tumors are absolute contraindications for both. Tesamorelin is FDA-approved for a specific indication (HIV lipodystrophy); somatropin is approved for multiple indications. Neither is a direct replacement for the other.

    How much visceral fat can I expect to lose on tesamorelin?

    In the FDA Phase 3 trials, patients on tesamorelin 2 mg/day lost about 15% of visceral adipose tissue (VAT) at 26 weeks, with reductions maintained through 52 weeks of continued dosing (Falutz et al., 2007; Falutz et al., 2010). The effect is preferential for visceral over subcutaneous fat - subcutaneous abdominal fat was largely unchanged in the same trials. Waist circumference typically reduces by 1-3 cm visibly. Effect plateaus around 26-52 weeks; patients who discontinue regain VAT within 26 weeks (the therapy is suppressive, not curative). Biohacker results in non-HIV populations are less systematically documented but generally consistent with the HIV lipodystrophy data when combined with proper diet and training.

    What are the common side effects of tesamorelin?

    The FDA-documented profile from Phase 3 trials: common - injection site reactions (~22%), arthralgia (joint aches), mild peripheral edema, myalgia, pain in extremities. Uncommon - carpal tunnel symptoms (fluid-shift-mediated), hand paresthesias, mild insulin resistance (HbA1c rises ~0.1% vs placebo). Rare - hyperglycemia / new-onset diabetes (rare in Phase 3 but possible with pre-existing risk factors), hypersensitivity reactions. Most effects are dose-dependent and resolve with dose reduction or cessation. Tesamorelin has no FDA black-box warning, unlike recombinant GH. Monitor IGF-1, fasting glucose, and HbA1c quarterly on long-term therapy.

    Can I stack tesamorelin with ipamorelin or semaglutide?

    Yes. Tesamorelin + ipamorelin is the canonical biohacking GHS stack: 2 mg tesamorelin + 200 mcg ipamorelin in the same pre-bed injection, producing a GH pulse 3-5x larger than either agent alone via GHRH x ghrelin receptor synergy. Tesamorelin + semaglutide or tirzepatide is an effective body recomposition stack: GLP-1 drives the caloric deficit while tesamorelin + ipamorelin preserves lean mass and preferentially reduces visceral fat. DO NOT stack tesamorelin with CJC-1295 with DAC (contradictory pharmacodynamics) or with recombinant GH (redundant and mechanistically confused).

    Does tesamorelin work for NAFLD (fatty liver disease)?

    Yes, off-label. Two randomized trials support this. In a 6-month trial of 50 HIV-infected adults with abdominal fat accumulation, tesamorelin 2 mg/day reduced liver fat with a net treatment effect of about -2.9% (lipid-to-water percentage), alongside a significant reduction in visceral fat (Stanley et al., 2014, JAMA). A larger 12-month trial in 61 HIV patients with confirmed NAFLD (hepatic fat fraction >=5%) found tesamorelin cut hepatic fat fraction by an absolute -4.1% - a 37% relative reduction from baseline - and 35% of treated patients reached a hepatic fat fraction below 5% versus 4% on placebo (Stanley et al., 2019, Lancet HIV). The mechanism is GH-driven hepatic lipid export and reduced portal free-fatty-acid flux from visceral fat. For documented NAFLD, a 6-12 month tesamorelin protocol with periodic liver-enzyme monitoring and baseline plus follow-up MRI-PDFF is the off-label framework. The FDA has not approved tesamorelin for NAFLD; use is physician-supervised off-label.

    Is tesamorelin legal and how do I get it?

    Tesamorelin is FDA-approved and available by prescription in the US, marketed as Egrifta SV by Theratechnologies. The FDA-approved indication is HIV-associated lipodystrophy; off-label prescription for non-HIV visceral adiposity or NAFLD is physician-dependent and less common due to insurance coverage limitations. Compounding pharmacy versions are available through integrative medicine clinics - typically less expensive than branded Egrifta. Research-chemical grade tesamorelin is sold online; quality varies enormously and users should verify with HPLC/mass spec COAs before use. See our Best Peptide Vendors 2026 guide for vetted sources. Legal status for personal use varies by jurisdiction.

    How long does tesamorelin take to work?

    Timeline from Phase 3 data: (1) IGF-1 elevation detectable at week 2, reaches steady state by week 4-6; (2) Sleep quality and subjective recovery improvements in weeks 1-3; (3) Waist circumference reduction measurable at week 8-12 (typically 1-2 cm); (4) Visceral fat reduction (VAT) - by CT or DEXA, measurable reduction begins at week 12 and reaches ~15% at week 26; (5) Hepatic fat reduction (NAFLD) - detectable at 3-6 months with continued therapy; (6) Effect plateaus around 26-52 weeks of continuous therapy. Discontinuation causes gradual reversal over 6-12 months - tesamorelin is a suppressive therapy, not curative for visceral adiposity.

    Research Tools

    Related Compounds

    View All

    CJC-1295 (Mod GRF 1-29)

    Growth Hormone / IGF-1 AxisPreclinical

    CJC-1295 without DAC (also called Modified GRF 1-29 or MOD-GRF 1-29) is a 30-amino-acid analog of the first 29 residues of endogenous Growth Hormone Releasing Hormone (GHRH), with four strategic substitutions (D-Ala² for DPP-4 resistance, Gln⁸, Ala¹⁵, Leu²⁷) that extend its plasma half-life from <2 minutes (native GHRH) to ~30 minutes.

    t½ ~30 minutes (without DAC / MOD-GRF 1-29); ~6-8 days (with DAC, due to covalent albumin binding) Without DAC: 100-300 mcg subcutaneous 1-3x daily (typically pre-bedtime); With DAC: 1000-2000 mcg subcutaneous once weekly
    29 studiesView Profile

    CJC-1295 with DAC

    Growth Hormone / IGF-1 AxisPhase 2

    CJC-1295 with DAC (Drug Affinity Complex) is a modified form of CJC-1295 that incorporates a maleimidopropionic acid (MPA) reactive group at the C-terminus.

    t½ 6–8 days (due to albumin binding via DAC) 1,000–2,000 mcg (1–2 mg) per injection
    PreclinicalView Profile

    CJC-1295 with DAC

    Growth Hormone / IGF-1 AxisPreclinical / Research peptide

    CJC-1295 with DAC is the long-acting variant of CJC-1295.

    t½ ~6-8 days (DAC-bound albumin depot) 1000-2000 mcg (1-2 mg) per week
    PreclinicalView Profile

    GHRP-2

    Growth Hormone / IGF-1 AxisPhase 2

    GHRP-2 (growth hormone-releasing peptide-2), also known as pralmorelin and KP-102, is a synthetic hexapeptide growth hormone secretagogue that was among the first GHRPs developed in the seminal research of Cyril Bowers and colleagues at Tulane University in the late 1980s and early 1990s.

    t½ ~15-30 minutes 100–300 mcg per injection
    212 studiesView Profile

    GHRP-6

    Growth Hormone / IGF-1 AxisPhase 2

    GHRP-6 (growth hormone-releasing peptide-6) is a synthetic hexapeptide with the sequence His-D-Trp-Ala-Trp-D-Phe-Lys-NH2 that binds the ghrelin receptor (GHS-R1a) to stimulate endogenous growth hormone release.

    t½ ~20–30 minutes 100–300 mcg per injection
    156 studiesView Profile

    Hexarelin

    Growth Hormone / IGF-1 AxisPhase 2

    Hexarelin (also called examorelin) is a potent synthetic hexapeptide growth hormone secretagogue with the sequence His-D-2-methyl-Trp-Ala-Trp-D-Phe-Lys-NH2.

    t½ ~55 minutes (IV, per Imbimbo 1994) 100–200 mcg per injection
    14 studiesView Profile

    Side-by-Side Comparisons

    All Comparisons

    Compare Tesamorelin head-to-head: mechanism, half-life, dosing, safety, and live pricing.

    Free 2026 Peptide Cheat Sheet — 50 pages, PDF

    Reconstitution math, concentration charts, half-lives, and vendor trust tiers. The reference we wish we had on day one.

    Download Free

    Need bloodwork before starting?

    Full hormone + metabolic panels from Anabolic Insights. Code CHONCH for first-order discount.