LL-37 vs Pinealon
Side-by-side comparison of LL-37 and Pinealon: mechanism, half-life, dose range, safety profile, and vendor pricing.
Price snapshot
LL-37
Pinealon
LL-37
LL-37 is the only human cathelicidin, a 37-amino-acid amphipathic alpha-helical peptide ([LL-37, 37 aa]) cleaved from the C-terminus of the 170-amino-acid precursor hCAP-18 (human cationic…
Lowest listed price: $45.00 across 2 listings
Full LL-37 profilePinealon
Pinealon is a synthetic tripeptide — glutamyl-aspartyl-arginine (Glu-Asp-Arg, or EDR) — developed by the St Petersburg Institute of Bioregulation and Gerontology (IBG) under the leadership of Professor Vladimir…
Lowest listed price: $45.00 across 3 listings
Full Pinealon profileSide-by-side comparison
| Attribute | LL-37 | Pinealon |
|---|---|---|
| Category | Immune & Inflammation | Nootropics |
| Research Stage | Clinical | Preclinical |
| Mechanism of Action | LL-37's biological activity spans three functional categories: direct antimicrobial, immunomodulatory, and tissue-remodeling. Each operates through partially distinct mechanisms. Direct Antimicrobial Mechanism (Membrane Disruption): LL-37 is a cationic… | The proposed mechanism of Pinealon is rooted in the Khavinson school's broader theory of short-peptide tissue-specific bioregulation. The full theory is worth understanding because it underlies all twelve Russian bioregulator compounds in this catalog. The… |
| Half-Life | ~30 minutes (free peptide; rapidly cleared by proteolysis). Human pharmacokinetics of exogenous LL-37 are not well characterized. | Not formally characterized in humans. Short regulatory peptides of this class are cleared from plasma within minutes; the Khavinson framework proposes durable downstream gene-expression effects that outlast the brief dosing window, which is the stated rationale for pulsed cycling rather than continuous dosing. |
| Typical Dose Range | — | Subcutaneous (primary route): 2-10 mg/day, typically 3-5 mg, in pulsed 10-20 day cycles, 2-4 cycles/year. Intranasal: 150-800 mcg per nostril daily. Research use only; oral dosing is not recommended because the peptide is largely degraded by GI proteases. |
| Dosing Frequency | — | Once daily during a cycle (morning preferred); some advanced users split into AM + midday doses. Not dosed continuously year-round - cycles are pulsed. |
| Administration | — | — |
| Side Effects | LL-37 has a less benign side-effect profile than many peptides covered in this guide, reflecting its mechanistic potency and narrow therapeutic window. Common (injection site): - Injection site irritation — more pronounced than with most peptides. Redness,… | The side-effect profile of Pinealon, based on the available Russian clinical literature and user-reported experience, is described as mild and uncommon. Whether this reflects genuinely low toxicity or inadequate reporting in the available studies is a… |
| Molecular Weight | 4493.4 g/mol | 418.40 g/mol (C15H26N6O8) |
| Common Vial Sizes | — | — |
Price History
2 data points- Ion Peptide
- Disguised Alpha
Price History
2 data points- Ion Peptide
- Disguised Alpha
LL-37: potential benefits
- Broad-spectrum antimicrobial activity
- Wound healing acceleration
- Biofilm disruption
- Immune system modulation
- Anti-inflammatory effects
- Gut barrier support
Pinealon: potential benefits
- Neuroprotection against oxidative and hypoxic stress (preclinical models)
- Antioxidant support - reduced oxidative DNA damage in aged neurons (in vitro)
- Cognitive and memory support in aging populations (small Russian clinical reports)
- Reduced neuronal apoptosis and support of dendritic-tree integrity in cell models
- Investigated for neuroprotection in Alzheimer's-model systems (preclinical)
Frequently asked
What's the difference between LL-37 and Pinealon?
LL-37 is a immune & inflammation that ll-37's biological activity spans three functional categories: direct antimicrobial, immunomodulatory, and tissue-remodeling. each operates through partially distinct mechanisms.…. Pinealon is a nootropics that the proposed mechanism of pinealon is rooted in the khavinson school's broader theory of short-peptide tissue-specific bioregulation. the full theory is worth understanding because…. The two differ in mechanism, half-life (~30 minutes (free peptide; rapidly cleared by proteolysis). Human pharmacokinetics of exogenous LL-37 are not well characterized. vs Not formally characterized in humans. Short regulatory peptides of this class are cleared from plasma within minutes; the Khavinson framework proposes durable downstream gene-expression effects that outlast the brief dosing window, which is the stated rationale for pulsed cycling rather than continuous dosing.), and typical dose range.
Which has the longer half-life, LL-37 or Pinealon?
LL-37 has a half-life of ~30 minutes (free peptide; rapidly cleared by proteolysis). Human pharmacokinetics of exogenous LL-37 are not well characterized.. Pinealon has a half-life of Not formally characterized in humans. Short regulatory peptides of this class are cleared from plasma within minutes; the Khavinson framework proposes durable downstream gene-expression effects that outlast the brief dosing window, which is the stated rationale for pulsed cycling rather than continuous dosing.. Longer half-lives generally mean less frequent dosing but slower on/off kinetics.
Which is cheaper, LL-37 or Pinealon?
Lowest listed price on BodyHackGuide: LL-37 from $45.00, Pinealon from $45.00. Prices are pulled from the vendor listings tracked on BHG and change frequently. See the compare tables on each compound page for the current set of offers.
Can you stack LL-37 and Pinealon?
Stacking depends on mechanism overlap, safety profile, and goals. LL-37 and Pinealon should only be stacked after reviewing each compound's individual protocol page, side effect profile, and any published interaction data. Use the BodyHackGuide stack builder for a structured review before combining research compounds.
See current vendor prices
Listings from the vendors we track. Prices change often, so check the vendor before you buy.
Before you buy LL-37 or Pinealon
Check the vendor trust score. Every supplier we track is rated 0-100 on COA verification, payment transparency, shipping, reviews, and listings: one published, reproducible methodology, applied to every vendor.
Related comparisons
Research use only. BodyHackGuide is a research and price-comparison reference. The compounds discussed on this page are not approved by the FDA for human consumption and are sold strictly for laboratory research. Prices shown are pulled from vendor listings tracked on BHG and are subject to change. Every vendor is ranked on the same public, reproducible methodology. See editorial standards and affiliate disclosure.