LL-37 vs ARA-290
Side-by-side comparison of LL-37 and ARA-290: mechanism, half-life, dose range, safety profile, and vendor pricing.
Price snapshot
LL-37
ARA-290
LL-37
LL-37 is the only human cathelicidin, a 37-amino-acid amphipathic alpha-helical peptide ([LL-37, 37 aa]) cleaved from the C-terminus of the 170-amino-acid precursor hCAP-18 (human cationic…
Lowest listed price: $45.00 across 2 listings
Full LL-37 profileARA-290
ARA-290, also known as Cibinetide or pHBSP (Helix B Surface Peptide), is an 11-amino-acid peptide — QEQLERALNSS — designed to mimic a specific region of the tissue-protective surface of erythropoietin (EPO) without…
Lowest listed price: $32.00 across 5 listings
Full ARA-290 profileSide-by-side comparison
| Attribute | LL-37 | ARA-290 |
|---|---|---|
| Category | Immune & Inflammation | Recovery |
| Research Stage | Clinical | Phase 2 |
| Mechanism of Action | LL-37's biological activity spans three functional categories: direct antimicrobial, immunomodulatory, and tissue-remodeling. Each operates through partially distinct mechanisms. Direct Antimicrobial Mechanism (Membrane Disruption): LL-37 is a cationic… | ARA-290's mechanism of action is one of the more elegantly engineered examples of pharmaceutical design in the peptide space. Understanding it requires appreciation of the dual-receptor biology of erythropoietin and the specific receptor-selective engineering… |
| Half-Life | ~30 minutes (free peptide; rapidly cleared by proteolysis). Human pharmacokinetics of exogenous LL-37 are not well characterized. | ~2 minutes (plasma half-life; downstream tissue-protective effects persist hours to days) |
| Typical Dose Range | — | 1 mg - 4 mg subcutaneous daily |
| Dosing Frequency | — | Once daily |
| Administration | — | — |
| Side Effects | LL-37 has a less benign side-effect profile than many peptides covered in this guide, reflecting its mechanistic potency and narrow therapeutic window. Common (injection site): - Injection site irritation — more pronounced than with most peptides. Redness,… | ARA-290 has demonstrated a notably favorable safety profile across clinical trials — one of the cleaner safety records among research peptides. The engineering rationale of separating tissue-protective effects from hematopoietic effects appears to have largely… |
| Molecular Weight | 4493.4 g/mol | ~1257 Da |
| Common Vial Sizes | — | — |
Price History
2 data points- Ion Peptide
- Disguised Alpha
Price History
3 data points- Ion Peptide
- BHG Labs
- LB
LL-37: potential benefits
- Broad-spectrum antimicrobial activity
- Wound healing acceleration
- Biofilm disruption
- Immune system modulation
- Anti-inflammatory effects
- Gut barrier support
ARA-290: potential benefits
- Neuroprotective effects
- Anti-inflammatory activity
- Tissue repair without erythropoiesis
- Potential diabetic neuropathy treatment
- Sarcoidosis symptom reduction
Frequently asked
What's the difference between LL-37 and ARA-290?
LL-37 is a immune & inflammation that ll-37's biological activity spans three functional categories: direct antimicrobial, immunomodulatory, and tissue-remodeling. each operates through partially distinct mechanisms.…. ARA-290 is a recovery that ara-290's mechanism of action is one of the more elegantly engineered examples of pharmaceutical design in the peptide space. understanding it requires appreciation of the…. The two differ in mechanism, half-life (~30 minutes (free peptide; rapidly cleared by proteolysis). Human pharmacokinetics of exogenous LL-37 are not well characterized. vs ~2 minutes (plasma half-life; downstream tissue-protective effects persist hours to days)), and typical dose range.
Which has the longer half-life, LL-37 or ARA-290?
LL-37 has a half-life of ~30 minutes (free peptide; rapidly cleared by proteolysis). Human pharmacokinetics of exogenous LL-37 are not well characterized.. ARA-290 has a half-life of ~2 minutes (plasma half-life; downstream tissue-protective effects persist hours to days). Longer half-lives generally mean less frequent dosing but slower on/off kinetics.
Which is cheaper, LL-37 or ARA-290?
Lowest listed price on BodyHackGuide: LL-37 from $45.00, ARA-290 from $32.00. Prices are pulled from the vendor listings tracked on BHG and change frequently. See the compare tables on each compound page for the current set of offers.
Can you stack LL-37 and ARA-290?
Stacking depends on mechanism overlap, safety profile, and goals. LL-37 and ARA-290 should only be stacked after reviewing each compound's individual protocol page, side effect profile, and any published interaction data. Use the BodyHackGuide stack builder for a structured review before combining research compounds.
See current vendor prices
Listings from the vendors we track. Prices change often, so check the vendor before you buy.
Before you buy LL-37 or ARA-290
Check the vendor trust score. Every supplier we track is rated 0-100 on COA verification, payment transparency, shipping, reviews, and listings: one published, reproducible methodology, applied to every vendor.
Related comparisons
Research use only. BodyHackGuide is a research and price-comparison reference. The compounds discussed on this page are not approved by the FDA for human consumption and are sold strictly for laboratory research. Prices shown are pulled from vendor listings tracked on BHG and are subject to change. Every vendor is ranked on the same public, reproducible methodology. See editorial standards and affiliate disclosure.