Skip to content

    Research Use Only

    This site is an educational resource for research compounds. We do not endorse human consumption of any compound. BodyHackGuide and BHG Labs share common ownership; we rank every vendor on the same public methodology, and we earn a commission on purchases through our links. By entering, you confirm you are 21 years of age or older and agree to our Terms & Privacy Policy.

    100K+ researchers trust BodyHackGuide — Join r/BodyHackGuide
    R

    Best price right now

    $12.00/mg· $119.99 for 10mg at ResearchChemHQ

    Across 5 verified vendors

    Retatrutide molecular structure

    Retatrutide

    Metabolic & Weight LossPhase 3

    Also known as: Triple Agonist, GLP-3, 4x Blend, RC-3R, PEP-3R, GLP-3 RT, GLP-R, Ion Peptide Retatrutide, GIP/GLP/Glucagon, ION-3R, GLP-3R, Retatrutide, Reta

    Retatrutide (also coded LY3437943) is an investigational once-weekly triple-agonist at the GLP-1, GIP, and glucagon receptors — the third-generation incretin-based therapy developed by Eli Lilly. Where Semaglutide activates GLP-1 alone and Tirzepatide activates both GLP-1 and GIP, retatrutide adds glucagon receptor agonism for synergistic effects on energy expenditure, hepatic lipid metabolism, and weight reduction. As of April 2026, retatrutide is not FDA-approved — it remains in Phase 3 clinical development.

    Half-Life: ~6 days (plasma, albumin-bound)Route: subcutaneousMW: 4731 g/molCAS: 2381294-46-4135 PubMed Studies
    Last reviewed:

    Reconstitution Calculator for Retatrutide

    Pre-filled · 10mg vial · 2000mcg dose

    Overview

    Best Price Available

    ⚗️

    ResearchChemHQ

    $119.99

    10mg vial · vial

    Coupon:REDDIT

    At A Glance

    Mechanism

    Retatrutide is a 39-amino-acid synthetic peptide with balanced agonist activity at three receptors: GLP-1R, GIPR, and GCGR (glucagon receptor). It is chemically modified with a C20 fatty diacid side chain (similar to semaglutide) to bind albumin and extend its plasma half-life to

    Half-Life
    ~6 days (plasma, albumin-bound)
    Dosing
    Once weekly subcutaneous injection
    Dose Range
    1,000–12,000 mcg (1–12 mg) per weekmcg
    Routes
    subcutaneous
    Common Vials
    5mgmg10mgmg
    Potential Benefits
    Body weight reduction up to 24% at 48 weeks (Phase 2 data)Glycemic control in T2DM — HbA1c reduction similar to tirzepatideHepatic fat reduction — potential MASH/NAFLD therapeutic effectModest increase in resting energy expenditure (3-5%)Preferential visceral fat reductionBlood pressure and lipid profile improvement (secondary to weight loss)Once-weekly dosing convenienceStrongest non-surgical weight loss demonstrated in clinical trials to date
    Safety Notes
    Common
    NauseaVomitingDiarrheaConstipationDecreased appetite

    Mechanism of Action

    Retatrutide is a 39-amino-acid synthetic peptide with balanced agonist activity at three receptors: GLP-1R, GIPR, and GCGR (glucagon receptor). It is chemically modified with a C20 fatty diacid side chain (similar to semaglutide) to bind albumin and extend its plasma half-life to ~6 days, enabling once-weekly subcutaneous dosing.

    1. GLP-1 receptor agonism (Gs / cAMP pathway on pancreatic beta cells and CNS)

    • Activates GLP-1R on pancreatic β-cells → glucose-dependent insulin secretion
    • Activates GLP-1R on hypothalamic POMC/NPY/AgRP neurons → appetite suppression
    • Slows gastric emptying → reduced postprandial glucose excursion and prolonged satiety
    • Same mechanism as semaglutide, tirzepatide, liraglutide

    EC₅₀ at human GLP-1R is roughly comparable to semaglutide.

    2. GIP receptor agonism (Gs / cAMP pathway on pancreatic beta cells and adipose tissue)

    • Activates GIPR on pancreatic β-cells → enhanced glucose-dependent insulin secretion
    • Activates GIPR on adipose tissue → complex effects on lipid storage and energy expenditure
    • Adds to GLP-1 effect on insulin secretion and satiety
    • Same "twincretin" mechanism as tirzepatide

    EC₅₀ at GIPR is comparable to tirzepatide.

    3. Glucagon receptor agonism — the retatrutide signature (Gs / cAMP pathway on hepatocytes and adipose tissue)

    This is what distinguishes retatrutide from semaglutide and tirzepatide:

    • Activates GCGR on hepatocytes → hepatic glucose output (transient, requires β-cell compensation)
    • Activates GCGR on hepatocytes → stimulation of hepatic fatty acid oxidation and reduction of hepatic lipid accumulation (the likely mechanism for retatrutide's strong NAFLD effects)
    • Activates GCGR on adipose tissue → enhanced lipolysis and energy expenditure (measurable ~3-5% increase in resting metabolic rate in Phase 2)
    • Activates GCGR in hypothalamus → additional appetite-suppressive effects

    The glucagon component is the reason retatrutide produces greater weight loss than GLP-1 + GIP alone. Glucagon drives both direct lipolysis and increased energy expenditure, adding to the appetite-suppressive effect of GLP-1/GIP. The net calculus:

    Effect GLP-1 (semaglutide) GLP-1 + GIP (tirzepatide) GLP-1 + GIP + GCG (retatrutide)
    Appetite suppression Strong Strong+ Strong++
    Insulin secretion Enhanced Enhanced+ Enhanced+
    Gastric emptying delay Strong Strong Strong
    Lipolysis Indirect (via caloric deficit) Modest direct effect Strong direct effect
    Energy expenditure Neutral Slight increase +3-5% REE
    Hepatic fat reduction Modest Moderate Strong

    4. Balanced agonist design

    Retatrutide is designed as a balanced triple agonist — relative potencies at GLP-1R, GIPR, and GCGR are within one order of magnitude of each other. This is in contrast to earlier experimental triple agonists that were biased toward one receptor. The balance enables the clinical profile observed in Phase 2.

    5. Pharmacokinetics

    • Plasma half-life: ~6 days (albumin-binding via C20 fatty diacid)
    • Steady state: achieved at ~4 weeks of weekly dosing
    • Dosing: once-weekly subcutaneous injection
    • Distribution: extensive albumin binding; moderate CNS penetration (enough for appetite-suppressive central effects)
    • Clearance: predominantly hepatic; minimal renal excretion

    Characterized in Phase 1 by [Urva et al., 2022].

    6. Secondary mechanisms under investigation

    • Brown adipose tissue activation — glucagon agonism likely activates BAT; may contribute to the energy expenditure increase
    • CNS energy-sensing neurons — GLP-1/GIP/GCG all signal at hypothalamic energy-sensing neurons; triple activation may produce qualitatively different satiety signaling than GLP-1 alone

    Overview

    Retatrutide (also coded LY3437943) is an investigational once-weekly triple-agonist at the GLP-1, GIP, and glucagon receptors — the third-generation incretin-based therapy developed by Eli Lilly. Where Semaglutide activates GLP-1 alone and Tirzepatide activates both GLP-1 and GIP, retatrutide adds glucagon receptor agonism for synergistic effects on energy expenditure, hepatic lipid metabolism, and weight reduction.

    As of April 2026, retatrutide is not FDA-approved — it remains in Phase 3 clinical development. Eli Lilly's TRIUMPH program is evaluating retatrutide for obesity, type 2 diabetes, NAFLD/MASH, and chronic kidney disease. The lead obesity indication (TRIUMPH-1) is expected to complete in 2026-2027 with potential FDA submission shortly thereafter.

    The clinical excitement around retatrutide is driven by the Phase 2 obesity trial data published in NEJM in 2023: participants on retatrutide 12 mg weekly achieved 24.2% body weight reduction at 48 weeks — the largest weight loss demonstrated by any non-surgical intervention to date, exceeding both semaglutide (~15% at 68 weeks in STEP-1) and tirzepatide (~21% at 72 weeks in SURMOUNT-1) ([Jastreboff et al., 2023]).

    Despite the strong efficacy signal, retatrutide's triple-receptor profile carries distinct safety considerations beyond the GLP-1 class:

    • Heart rate elevation — mean ~6-8 bpm increase (larger than semaglutide or tirzepatide), likely driven by the glucagon-receptor component
    • Transient elevation of fasting glucose during uptitration (glucagon receptor effect on hepatic glucose output) — usually self-limited
    • Higher rate of GI adverse events at the 12 mg maximal dose compared to lower doses and compared to GLP-1-only agents
    • Unknown long-term cardiovascular outcomes — large Phase 3 cardiovascular outcome trials are ongoing

    Regulatory status: Not FDA-approved. Available only through clinical trials, research-chemical channels, and (controversially) compounding pharmacies in some jurisdictions using non-commercial retatrutide sourcing. The FDA has not announced an approval pathway timeline.

    Typical dosing (extrapolated from Phase 2 uptitration schedule): starting 2 mg weekly SC, titrating to 8-12 mg weekly over 12-20 weeks. The maximal dose of 12 mg weekly is associated with the largest weight loss and the largest side-effect burden. See our Retatrutide Dosage Guide for uptitration specifics and our Semaglutide vs Tirzepatide vs Retatrutide comparison for class-selection context.

    Potential Research Fields

    ObesityType 2 diabetesMetabolic syndromeNASH

    Phase 2 Trial Data — Record-Breaking Weight Loss

    Eli Lilly's Phase 2 trial (n=338, published in NEJM 2023) tested retatrutide at doses from 1mg to 12mg weekly over 48 weeks in adults with obesity (BMI ≥30) or overweight (BMI ≥27) with at least one weight-related condition.

    24.2%

    Mean weight loss at 12mg (48 wk)

    26%

    Participants losing ≥30% BW

    86%

    Reduction in liver fat

    Dose-Response Weight Loss at 48 Weeks

    1 mg
    -8.7%
    4 mg (low)
    -17.1%
    4 mg (high)
    -17.5%
    8 mg (low)
    -22.1%
    8 mg (high)
    -22.8%
    12 mg
    -24.2%

    Phase 3: TRIUMPH program currently enrolling for obesity and MASLD/NASH. Results expected 2025–2026.

    Triple Agonism — Why 3 Receptors Matter

    GLP-1 Receptor

    Suppresses appetite, enhances insulin secretion, slows gastric emptying. Same pathway as semaglutide.

    GIP Receptor

    Modulates lipid metabolism and adipose tissue function. Combined with GLP-1 in tirzepatide.

    Glucagon Receptor

    Key differentiator. Increases hepatic energy expenditure, fat oxidation, and thermogenesis. Unique to retatrutide.

    Retatrutide vs Tirzepatide vs Semaglutide

    Compound Targets Max Weight Loss Trial Status
    Semaglutide GLP-1 ~15% STEP trials FDA Approved
    Tirzepatide GLP-1 + GIP ~21% SURMOUNT FDA Approved
    Retatrutidebest GLP-1 + GIP + Glucagon ~24.2% Phase 2 / TRIUMPH Phase 3

    Cross-trial comparisons — interpret with caution due to study population differences.

    Phase 2 Titration Schedule

    Weeks 1–21 mg/weekStarting dose
    Weeks 3–42 mg/weekFirst escalation
    Weeks 5–84 mg/weekIntermediate dose
    Weeks 9–128 mg/weekHigh dose
    Weeks 13–4812 mg/weekMaximum (if tolerated)

    Do not skip titration. Jumping to high doses significantly increases GI side effects. If intolerable, stay at current dose for 2 extra weeks before escalating.

    Detailed Side Effects

    Common (≥10%)

    • Nausea (dose-dependent, usually improves)
    • Diarrhea
    • Constipation
    • Decreased appetite
    • Vomiting (mostly during titration)

    Less Common

    • Increased heart rate
    • Injection site reactions
    • Fatigue
    • Dizziness
    • Preclinical thyroid C-cell concerns

    Contraindications: Do NOT combine with semaglutide, tirzepatide, or other GLP-1 agonists. Avoid if personal/family history of medullary thyroid carcinoma or MEN2.

    Retatrutide FAQ

    What is retatrutide (LY3437943)?
    Retatrutide is an investigational triple hormone receptor agonist developed by Eli Lilly that simultaneously activates GLP-1, GIP, and glucagon receptors. It is the first drug to target all three metabolic pathways, producing the largest weight loss ever recorded in a clinical trial — up to 24.2% at 48 weeks.
    How does retatrutide differ from tirzepatide and semaglutide?
    Semaglutide targets GLP-1 only. Tirzepatide targets GLP-1 + GIP (dual agonist). Retatrutide targets GLP-1 + GIP + glucagon (triple agonist). The glucagon receptor activation uniquely drives hepatic energy expenditure, fat oxidation, and thermogenesis — mechanisms unavailable to single or dual agonists.
    What were the retatrutide Phase 2 trial results?
    The Phase 2 trial (n=338) showed up to 24.2% mean body weight reduction with the 12mg dose at 48 weeks. 26% of participants lost ≥30% of body weight. Liver fat was reduced by up to 86%. These results significantly exceeded semaglutide (~15%) and tirzepatide (~21%) at comparable timepoints.
    What are retatrutide's side effects?
    Common side effects include nausea, vomiting, diarrhea, constipation, and decreased appetite — similar to other GLP-1 agonists. Additional effects include increased heart rate, injection site reactions, and fatigue. Preclinical thyroid concerns have been noted. Most GI side effects were dose-dependent and improved with titration.
    What is the retatrutide dosing protocol?
    Per the Phase 2 trial protocol: start at 1mg subcutaneous once weekly for 2 weeks, then titrate up through 2mg, 4mg, 8mg, and potentially 12mg over 24 weeks. The ~6-day half-life supports weekly dosing. Slow titration minimizes GI side effects.
    Is retatrutide FDA approved?
    No. Retatrutide is currently in Phase 3 clinical trials (TRIUMPH program) for obesity and MASLD/NASH. It is available only as a research compound. FDA approval is not expected before 2026–2027 at the earliest.
    Can I stack retatrutide with semaglutide or tirzepatide?
    No. Retatrutide already includes GLP-1 agonism. Stacking with semaglutide or tirzepatide would produce dangerous overlapping GLP-1 activity and is strongly contraindicated.

    Chemical Information

    IUPAC Name

    Not fully disclosed (Eli Lilly proprietary)

    CAS Number

    2381294-46-4

    Molecular Formula

    C221H342N46O68

    Molecular Mass

    4731 g/mol

    Amino Acid Sequence

    39-amino-acid synthetic peptide; GIP/GLP-1/glucagon triple receptor agonist (Eli Lilly LY3437943; CAS 2381089-83-2). Backbone (N->C, one-letter): YAQGTFTSDYSILLDKKAQAAFIEYLLEGGPSSGAPPPS. Key modifications (per the published structure): 2-aminoisobutyric acid (Aib) at positions 2 and 20; a C20 fatty diacid conjugated to a lysine side chain via a gamma-Glu/AEEA linker (albumin-binding moiety that extends the plasma half-life to ~6 days); C-terminal amidation. Molecular formula C221H342N46O68; molecular weight ~4731 g/mol.

    Dosing & Protocols

    Unlock Dosing Protocols

    Free account gets you:

    • View beginner, intermediate & advanced protocols
    • See weight-based dosing calculations
    • Access cycle length & frequency data

    2,800+ researchers already in

    Research

    Unlock Research Data

    Free account gets you:

    • Browse PubMed study summaries
    • See clinical trial phases & results
    • Access mechanism of action details

    2,800+ researchers already in

    Interactions

    Interaction Matrix

    Contraindications

    Absolute contraindications

    • Personal or family history of medullary thyroid carcinoma (MTC) — GLP-1 class rodent carcinogenicity signal; absolute contraindication
    • Multiple Endocrine Neoplasia syndrome type 2 (MEN-2) — same signal
    • History of acute pancreatitis — GLP-1 class signal; recurrence risk
    • Active gallbladder disease / acute cholecystitis — GLP-1 class worsens
    • Active malignancy — relative to absolute depending on type; GLP-1 class has some residual oncology concerns
    • Pregnancy or planning pregnancy — no safety data; avoid
    • Breastfeeding — no safety data
    • Age <18 — no pediatric data for retatrutide (some GLP-1 class drugs have pediatric obesity approvals; retatrutide does not)
    • Severe gastroparesis or gastric outlet obstruction — GLP-1 mechanism would dramatically worsen

    Relative contraindications (consult physician before use)

    • History of chronic pancreatitis — increased recurrence risk
    • Active proliferative diabetic retinopathy — rapid glycemic correction can worsen retinopathy
    • Resting tachycardia (HR >90 at baseline) — retatrutide consistently raises HR; investigate baseline cause first
    • Severe heart failure (NYHA III-IV) — limited data; the heart rate elevation may be problematic
    • Active eating disorder (anorexia nervosa / bulimia) — appetite suppression is dangerous
    • Severe hepatic impairment (Child-Pugh C) — hepatic clearance is primary
    • Severe chronic kidney disease (eGFR <30) — limited data

    Drug interactions

    • Sulfonylureas (glipizide, glyburide) — hypoglycemia risk; reduce dose 50% when starting retatrutide
    • Insulin — hypoglycemia risk; reduce insulin dose at retatrutide initiation
    • Other GLP-1 receptor agonists — redundant; discontinue before starting retatrutide
    • Warfarin — GLP-1 class may alter INR; monitor more frequently at dose changes
    • Oral contraceptives — GLP-1-induced gastric delay may reduce efficacy; consider non-oral contraception during active uptitration
    • Acetaminophen / paracetamol — gastric delay may reduce Cmax; usually not clinically significant
    • Any drug with narrow therapeutic index requiring predictable absorption — monitor at dose changes

    Specific populations requiring extra caution

    • History of depression / suicidal ideation — some GLP-1 class drugs have FDA adverse event signals for suicidality; monitor
    • History of retinopathy — annual ophthalmology during rapid weight loss
    • Post-bariatric surgery — limited data on GLP-1 class post-surgery; absorption may be altered

    Monitoring requirements

    • Baseline: HbA1c, fasting glucose, lipid panel, CMP, liver function, thyroid (TSH + free T4), blood pressure, resting heart rate (seated, post-rest), pregnancy test (women of childbearing age), eye exam (for diabetics or high-risk)
    • Every 4 weeks during uptitration: fasting glucose, blood pressure, heart rate, weight, subjective tolerance
    • Every 12 weeks on maintenance: HbA1c, liver function, lipids, weight, body composition
    • Annually: Full panel + cardiovascular assessment + ophthalmology (if diabetic)

    Discontinuation criteria

    Stop retatrutide and consult a clinician if you develop:

    • Severe persistent GI symptoms limiting food intake
    • Any suspected pancreatitis symptoms (severe abdominal pain radiating to back)
    • Severe hypoglycemia (glucose <54 mg/dL)
    • Resting HR >100 bpm or new arrhythmia
    • Severe depression or suicidal ideation
    • Acute gallbladder symptoms
    • Unexplained dehydration or electrolyte derangement
    • Planning pregnancy

    Research Disclaimer

    This interaction data is compiled from published research and community reports. It may not be exhaustive. Always consult a healthcare professional before combining compounds.

    Best Price

    $79.99

    up to $279.99

    Best $/mg

    $7.9995

    Vendors

    5

    Listings

    11

    vial

    Dosage
    Form
    Sort
    Vendor Product Form Qty Price $/mg Coupon
    ResearchChemHQ logo
    ResearchChemHQ
    100
    🇺🇸US
    RC-3R 10mg vial 10mg vial● In Stock $119.99BEST $11.999
    BHG Labs logo
    BHG Labs
    70
    🇺🇸US
    BHG-3R 10mg (Retatrutide) vial 1 vial● In Stock $120.00 $12.000
    Optimum Formula logo
    Optimum Formula
    100
    🇺🇸US
    Pep-3R 10mg (Retatrutide) vial 1 vial● In Stock $119.99 $11.999
    BioMyst Labs logo
    BioMyst Labs
    70
    🇺🇸US🌍International
    Retatrutide 10mg vial 1 vial● In Stock $99.99 $9.999
    BioMyst Labs logo
    BioMyst Labs
    70
    🇺🇸US🌍International
    Retatrutide 10mg vial 1 vial● In Stock $119.99 $11.999
    BioMyst Labs logo
    BioMyst Labs
    70
    🇺🇸US🌍International
    Retatrutide 20mg vial 1 vial● In Stock $159.99 $8.000
    BioMyst Labs logo
    BioMyst Labs
    70
    🇺🇸US🌍International
    Retatrutide 20mg vial 1 vial● In Stock $199.99 $10.000
    VANDL Labs logo
    VANDL Labs
    50
    🇺🇸US
    GLP-Reta (Retatrutide) 5mg vial 5mg vial● In Stock $79.99 $15.998
    VANDL Labs logo
    VANDL Labs
    50
    🇺🇸US
    GLP-Reta (Retatrutide) 10mg vial 10mg vial● In Stock $119.99 $11.999
    VANDL Labs logo
    VANDL Labs
    50
    🇺🇸US
    GLP-Reta (Retatrutide) 15mg vial 15mg vial● In Stock $159.99 $10.666
    VANDL Labs logo
    VANDL Labs
    50
    🇺🇸US
    GLP-Reta (Retatrutide) 30mg vial 30mg vial● In Stock $279.99 $9.333

    Get Retatrutide Price Drop Alerts

    Set a target price and we'll notify you when any vendor drops below it. Current lowest: $79.99

    Sign in to leave a review

    Reviews on BodyHackGuide are tied to verified user accounts and moderated before publishing. Sign in (free, no spam) to share your experience with Retatrutide.

    Current low
    $120.00
    as of Jul 1, 2026
    7-day low
    no 7d data yet
    30-day low
    no 30d data yet
    30-day change
    baseline building

    Tracking since Mar 13, 2026 · 23 data points

    Price History

    6 data points

    Vendors Selling Retatrutide

    How we score these vendors

    Every supplier above is graded 0–100 on COA verification, payment transparency, shipping, reviews, and active listings. Methodology published, no pay-to-rank.

    View Scorecard

    Related Compounds

    View All

    AOD-9604

    Metabolic & Weight LossPhase 3

    AOD-9604 (Anti-Obesity Drug 9604) is a synthetic 16-amino-acid peptide fragment of human growth hormone (hGH) corresponding to residues 177-191 of the hGH molecule plus a tyrosine addition at the N-terminus (sequence: Tyr-Leu-Arg-Ile-Val-Gln-Cys-Arg-Ser-Val-Glu-Gly-Ser-Cys-Gly-Phe).

    t½ ~30–60 minutes 250–600 mcg per injection
    1 studiesView Profile

    ATX-304

    Metabolic & Weight LossPhase IIa Clinical Trials

    ATX-304 (also known as O-304) is an orally bioavailable, first-in-class pan-AMPK activator with a mild mitochondrial-uncoupling effect.

    PreclinicalView Profile

    Cagrilintide

    Metabolic & Weight LossPhase 3

    Cagrilintide (also known as AM833, development code NN9838) is a long-acting amylin analog developed by Novo Nordisk as a next-generation weight-management therapy, designed to be co-administered with the GLP-1 receptor agonist semaglutide in a fixed-ratio combination known as CagriSema.

    t½ ~159 hours (approximately 7 days)
    46 studiesView Profile

    HGH Fragment 176-191

    Metabolic & Weight LossPhase 2

    HGH Fragment 176-191 (also written HGH Frag 176-191, hGH Fragment 176-191, and frequently appearing in clinical literature as AOD-9604 — "Anti-Obesity Drug 9604") is a synthetic peptide corresponding to the C-terminal 15-amino-acid region of the 191-amino-acid human growth hormone (hGH) molecule, with an additional N-terminal tyrosine residue added for stability and biological activity.

    t½ ~30 minutes (short plasma half-life) 250-500
    2 studiesView Profile

    Semaglutide

    Metabolic & Weight LossFDA Approved

    Semaglutide is a glucagon-like peptide-1 receptor agonist (GLP-1 RA) with a molecular weight of 4113.58 Da and CAS number 910463-68-2.

    t½ ~7 days (168 hours), enabled by C18 fatty diacid albumin-binding modification Diabetes (Ozempic): 250-1000 mcg weekly; Weight management (Wegovy): 2400 mcg weekly (after 16-week titration); Oral (Rybelsus): 3-14 mg daily
    3273 studiesView Profile

    Tirzepatide

    Metabolic & Weight LossFDA Approved

    Tirzepatide is a dual glucose-dependent insulinotropic polypeptide (GIP) and glucagon-like peptide-1 (GLP-1) receptor agonist with a molecular weight of 4813.45 Da and CAS number 2023788-19-2.

    t½ ~5 days (approximately 120 hours), enabled by C20 fatty diacid albumin-binding modification 2500 mcg (2.5 mg) starting dose, titrated every 4 weeks through 5000, 7500, 10000, 12500, to 15000 mcg (15 mg) maximum weekly dose
    626 studiesView Profile

    View Full Dosage Guide →

    Protocols, calculator & safety for Retatrutide

    Related Articles

    All Posts

    Tesamorelin: A Complete Research Reference

    Tesamorelin is a synthetic, stabilized GHRH analog approved as Egrifta for HIV-associated visceral fat. This guide covers the real trial evidence for visceral fat, liver fat, and cognition, how it differs from CJC-1295 and from GH itself, the approved and studied doses, and how the peptide-research community discusses it, with research-use-only framing throughout.

    7/1/2026

    Aquasome Nanotechnology and Oral Peptides: The Mechanism, the Research, and the 10 Compounds It Actually Works For

    how aquasome 3-layer nano-encapsulation lets peptides like retatrutide, bpc-157, and tb-500 survive the gut. pubmed-backed deep dive on the 10 compounds it works for.

    5/20/2026

    Retatrutide Protocol Guide: What the Phase 2 Trial Actually Showed

    An education-first walkthrough of retatrutide (LY3437943), the triple GLP-1/GIP/glucagon agonist. Covers the Phase 2 NEJM trial data at 24 and 48 weeks, the trial titration schedule, side effects, reconstitution, and honest sourcing. Research-use-only, not FDA-approved, not medical advice.

    5/19/2026

    Best Price

    ⚗️

    ResearchChemHQ

    $119.99

    5 vendors · 11 listings

    Research Score

    74

    135 PubMed studies

    Quality Indicators

    Data Completeness

    100%
    Description
    Mechanism of Action
    Chemical Data
    Dosing Protocols
    Safety Profile
    PubMed Studies
    Interactions
    Vendor Listings

    COA Verification

    10

    Verified COAs

    2

    Vendors w/ COA

    High verification rate (83%)

    Latest test: 3/1/2026

    Research Credibility

    135PubMed studies

    Well-researched compound

    Quick Facts

    Half-Life

    ~6 days (plasma, albumin-bound)

    Molecular Weight

    4731 g/mol

    Administration

    subcutaneous

    CAS Number

    2381294-46-4

    Trial Phase

    Phase 3

    Safety Profile

    Moderate Risk

    Common Side Effects

    • Nausea
    • Vomiting
    • Diarrhea
    • Constipation
    • Decreased appetite

    Stop Use If

    • Phase 3 trials ongoing — long-term safety profile still being established
    • Thyroid tumor history
    • Severe GI events

    Research Disclaimer

    This information is for educational and research purposes only. Not intended as medical advice. Consult a healthcare professional before use.

    Frequently Asked Questions

    What is retatrutide (LY3437943)?

    Retatrutide is an investigational triple hormone receptor agonist developed by Eli Lilly that simultaneously activates GLP-1, GIP, and glucagon receptors. It is the first drug to target all three metabolic pathways, producing the largest weight loss ever recorded in a clinical trial — up to 24.2% at 48 weeks.

    How does retatrutide differ from tirzepatide and semaglutide?

    Semaglutide targets GLP-1 only. Tirzepatide targets GLP-1 + GIP (dual agonist). Retatrutide targets GLP-1 + GIP + glucagon (triple agonist). The glucagon receptor activation uniquely drives hepatic energy expenditure, fat oxidation, and thermogenesis — mechanisms unavailable to single or dual agonists.

    What were the retatrutide Phase 2 trial results?

    The Phase 2 trial (n=338) showed up to 24.2% mean body weight reduction with the 12mg dose at 48 weeks. 26% of participants lost ≥30% of body weight. Liver fat was reduced by up to 86%. These results significantly exceeded semaglutide (~15%) and tirzepatide (~21%) at comparable timepoints.

    What are retatrutide's side effects?

    Common side effects include nausea, vomiting, diarrhea, constipation, and decreased appetite — similar to other GLP-1 agonists. Additional effects include increased heart rate, injection site reactions, and fatigue. Preclinical thyroid concerns have been noted. Most GI side effects were dose-dependent and improved with titration.

    What is the retatrutide dosing protocol?

    Per the Phase 2 trial protocol: start at 1mg subcutaneous once weekly for 2 weeks, then titrate up through 2mg, 4mg, 8mg, and potentially 12mg over 24 weeks. The ~6-day half-life supports weekly dosing. Slow titration minimizes GI side effects.

    Is retatrutide FDA approved?

    No. Retatrutide is currently in Phase 3 clinical trials (TRIUMPH program) for obesity and MASLD/NASH. It is available only as a research compound. FDA approval is not expected before 2026–2027 at the earliest.

    Can I stack retatrutide with semaglutide or tirzepatide?

    No. Retatrutide already includes GLP-1 agonism. Stacking with semaglutide or tirzepatide would produce dangerous overlapping GLP-1 activity and is strongly contraindicated.

    Research Tools

    Related Compounds

    View All

    AOD-9604

    Metabolic & Weight LossPhase 3

    AOD-9604 (Anti-Obesity Drug 9604) is a synthetic 16-amino-acid peptide fragment of human growth hormone (hGH) corresponding to residues 177-191 of the hGH molecule plus a tyrosine addition at the N-terminus (sequence: Tyr-Leu-Arg-Ile-Val-Gln-Cys-Arg-Ser-Val-Glu-Gly-Ser-Cys-Gly-Phe).

    t½ ~30–60 minutes 250–600 mcg per injection
    1 studiesView Profile

    ATX-304

    Metabolic & Weight LossPhase IIa Clinical Trials

    ATX-304 (also known as O-304) is an orally bioavailable, first-in-class pan-AMPK activator with a mild mitochondrial-uncoupling effect.

    PreclinicalView Profile

    Cagrilintide

    Metabolic & Weight LossPhase 3

    Cagrilintide (also known as AM833, development code NN9838) is a long-acting amylin analog developed by Novo Nordisk as a next-generation weight-management therapy, designed to be co-administered with the GLP-1 receptor agonist semaglutide in a fixed-ratio combination known as CagriSema.

    t½ ~159 hours (approximately 7 days)
    46 studiesView Profile

    HGH Fragment 176-191

    Metabolic & Weight LossPhase 2

    HGH Fragment 176-191 (also written HGH Frag 176-191, hGH Fragment 176-191, and frequently appearing in clinical literature as AOD-9604 — "Anti-Obesity Drug 9604") is a synthetic peptide corresponding to the C-terminal 15-amino-acid region of the 191-amino-acid human growth hormone (hGH) molecule, with an additional N-terminal tyrosine residue added for stability and biological activity.

    t½ ~30 minutes (short plasma half-life) 250-500
    2 studiesView Profile

    Semaglutide

    Metabolic & Weight LossFDA Approved

    Semaglutide is a glucagon-like peptide-1 receptor agonist (GLP-1 RA) with a molecular weight of 4113.58 Da and CAS number 910463-68-2.

    t½ ~7 days (168 hours), enabled by C18 fatty diacid albumin-binding modification Diabetes (Ozempic): 250-1000 mcg weekly; Weight management (Wegovy): 2400 mcg weekly (after 16-week titration); Oral (Rybelsus): 3-14 mg daily
    3273 studiesView Profile

    Tirzepatide

    Metabolic & Weight LossFDA Approved

    Tirzepatide is a dual glucose-dependent insulinotropic polypeptide (GIP) and glucagon-like peptide-1 (GLP-1) receptor agonist with a molecular weight of 4813.45 Da and CAS number 2023788-19-2.

    t½ ~5 days (approximately 120 hours), enabled by C20 fatty diacid albumin-binding modification 2500 mcg (2.5 mg) starting dose, titrated every 4 weeks through 5000, 7500, 10000, 12500, to 15000 mcg (15 mg) maximum weekly dose
    626 studiesView Profile

    Side-by-Side Comparisons

    All Comparisons

    Compare Retatrutide head-to-head: mechanism, half-life, dosing, safety, and live pricing.

    Free 2026 Peptide Cheat Sheet — 50 pages, PDF

    Reconstitution math, concentration charts, half-lives, and vendor trust tiers. The reference we wish we had on day one.

    Download Free

    Need bloodwork before starting?

    Full hormone + metabolic panels from Anabolic Insights. Code CHONCH for first-order discount.