Compare notes on r/BodyHackGuideCompare notes with other researchers. Join r/BodyHackGuide

Exenatide

Status: FDA-approved
Evidence: Not graded on a research bench yet

Exenatide (Byetta, Bydureon) is a synthetic exendin-4 GLP-1 receptor agonist, FDA-approved for type 2 diabetes, that lowers blood glucose and curbs appetite.

Reviewed 28 October 2026

01Overview

What Exenatide is

Available as a twice-daily immediate-release and a once-weekly extended-release injection.

How it works

Exenatide is a synthetic form of exendin-4, a 39-amino-acid peptide first isolated from the saliva of the Gila monster (Heloderma suspectum). It shares about 53 percent of its sequence with human GLP-1 but, unlike native GLP-1, resists breakdown by the DPP-4 enzyme, so it stays active far longer.

Read the full mechanismShow less

As a GLP-1 receptor agonist it works through several complementary mechanisms:

Glucose-dependent insulin release: it prompts the pancreatic beta cells to secrete insulin mainly when blood glucose is elevated, which keeps hypoglycemia risk low when it is used on its own.
Glucagon suppression: it lowers inappropriately high glucagon output from the alpha cells, reducing the liver's glucose production.
Slowed gastric emptying: food leaves the stomach more slowly, blunting post-meal glucose spikes and prolonging fullness.
Appetite and satiety: it acts on central appetite centers to reduce hunger and food intake, which drives the weight loss seen in trials.

The immediate-release version (Byetta) is cleared quickly and given twice daily before meals. The extended-release version (Bydureon) uses biodegradable microspheres that release the same molecule slowly over weeks, allowing once-weekly dosing.

Benefits listed

Meaningful glycemic control in type 2 diabetes, with HbA1c reductions of roughly 1.0 to 1.9 percent in randomized trials
Weight reduction of about 2 to 3 kg in diabetic trials, driven mainly by reduced appetite and slower gastric emptying
Low intrinsic hypoglycemia risk because insulin release is glucose-dependent (risk rises when combined with sulfonylureas or insulin)
Strong control of post-meal glucose spikes

Show 4 moreShow less

Cardiovascular safety shown in a large outcomes trial, with no increase in major cardiac events
Can be added to basal insulin to improve control while offsetting insulin-related weight gain
Once-weekly extended-release option (Bydureon) reduces injection burden versus twice-daily dosing
In people without diabetes the appetite effect is real, but standalone weight loss has been modest and less consistent than newer agents such as [semaglutide](/compound/semaglutide) or [tirzepatide](/compound/tirzepatide)

What to expect

- First 1 to 4 weeks: nausea and reduced appetite are common while the body adjusts; the low 5 mcg starter dose is used to ease this in
- Weeks 4 to 8: on the full dose, appetite suppression and post-meal glucose control are most noticeable and early weight loss begins
- For the once-weekly extended-release form, blood levels and full effect build gradually over about 6 to 7 weeks
- Gastrointestinal side effects usually lessen over time; small injection-site nodules can appear with the weekly form
- Weight and glucose effects are modest compared with newer agents such as [semaglutide](/compound/semaglutide) or [tirzepatide](/compound/tirzepatide)

Individual responses vary. Timeline based on commonly reported research observations.

02Research

Free with email

What the research shows

No research bench grades Exenatide yet. Benches compare compounds people pair, with the evidence for each.

Key research findings

Exenatide is one of the most extensively studied GLP-1 receptor agonists, with a clinical record stretching back to the AMIGO program of the mid-2000s and dozens of randomized trials since. Note: these are human trials in people with type 2 diabetes (or, in one case, non-diabetic obesity); this summary is educational and research-use-only.

Read all the findingsShow less

Twice-daily (Byetta): In a 26-week head-to-head trial against insulin glargine, exenatide 10 mcg twice daily lowered HbA1c by 1.1 percent (matching glargine) while producing a 2.3 kg weight loss versus a 1.8 kg gain on insulin. Nausea was far more common on exenatide (57 percent vs 9 percent) [PMID:16230722].

Once-weekly (Bydureon): DURATION-1 compared the extended-release 2 mg weekly formulation with the twice-daily version over 30 weeks. The weekly dose cut HbA1c more (-1.9 percent vs -1.5 percent) with similar weight loss and no extra hypoglycemia [PMID:18782641]. A pooled analysis of seven phase 3 trials (1,719 patients) confirmed consistent HbA1c, fasting-glucose, and weight improvements across age, sex, race, and BMI subgroups; the main side effects were gastrointestinal [PMID:22925173].

Head-to-head vs other GLP-1s: In DURATION-6, once-weekly exenatide was slightly less effective than daily liraglutide 1.8 mg (HbA1c -1.28 percent vs -1.48 percent) but caused less nausea, vomiting, and diarrhea [PMID:23141817]. In SUSTAIN 3, once-weekly semaglutide 1.0 mg clearly outperformed exenatide extended-release on both glucose (-1.5 percent vs -0.9 percent HbA1c) and weight (-5.6 kg vs -1.9 kg); injection-site reactions were more common with exenatide extended-release [PMID:29246950].

Cardiovascular safety: EXSCEL, a 14,752-patient outcomes trial, found once-weekly exenatide was safe for major cardiovascular events but did not significantly reduce them (hazard ratio 0.91, p=0.06 for superiority) [PMID:28910237].

Combination and non-diabetic use: Twice-daily exenatide has been added to basal insulin to improve control without the weight gain of prandial insulin [PMID:23061886]. In non-diabetic adults with obesity, a randomized trial showed exenatide 10 mcg twice daily cut food intake but did not change energy expenditure, and the weight difference versus placebo was not statistically significant at 24 weeks - a reminder that its weight effect on its own is modest [PMID:29596853].

Safety and side effects

Gastrointestinal effects are by far the most common: nausea (reported in roughly 40 to 57 percent of patients on the twice-daily form, usually worst early and fading over weeks), vomiting, diarrhea, constipation, and dyspepsia. Reduced appetite is expected. Other reported effects include headache, dizziness, jitteriness, and injection-site reactions - small subcutaneous nodules are especially common with the extended-release (weekly) formulation. Hypoglycemia is uncommon with exenatide alone but rises when it is combined with a sulfonylurea or insulin. Less common but serious concerns include acute pancreatitis, gallbladder disease, and acute kidney injury (usually linked to dehydration from nausea or vomiting). The extended-release product carries a boxed warning for thyroid C-cell tumors based on rodent studies.

On PubMed

The search Exenatide on PubMed.

Browse studies on PubMed

Unlock the research summary

Enter your email to keep reading. It is free, and it opens these sections on every compound page in this browser.

A summary of the key research
Safety and side effects
A link to the PubMed results

You also get the free peptide cheat sheet by email. Unsubscribe anytime.

Have an account? Sign in

03Safety

Exenatide side effects and interactions

Side effects

Not in our record

Our record lists no side effects for Exenatide. That means none are recorded here, not that there are none. The Research section has the written safety notes.

Who should not use it

Contraindications

Do not use with a personal or family history of medullary thyroid carcinoma or Multiple Endocrine Neoplasia syndrome type 2 (boxed warning for the extended-release form). Contraindicated after any prior serious hypersensitivity reaction to exenatide. Not recommended in severe renal impairment (creatinine clearance under 30 mL/min) or end-stage renal disease, because clearance is kidney-dependent. Use caution or avoid with a history of pancreatitis, severe gastrointestinal disease, or gastroparesis. Exenatide does not treat type 1 diabetes or diabetic ketoacidosis. It is not recommended in pregnancy or breastfeeding, and it is not FDA-approved for weight loss or for use in people without diabetes.

Interactions

4 pairings in our record: 4 not rated.

Not rated

Sulfonylureas and insulin: additive hypoglycemia risk, so these are often dose-reduced when exenatide is started
Not rated

Oral drugs that need precise timing (some antibiotics, oral contraceptives): slowed gastric emptying can delay their absorption, so take them at least 1 hour before an exenatide injection
Not rated

Warfarin: rare reports of increased INR; monitor when starting
Not rated

Other GLP-1 receptor agonists or DPP-4 inhibitors: should not be combined because of overlapping mechanism

This interaction data is compiled from published research and community reports. It may not be exhaustive. Always consult a healthcare professional before combining compounds.

Need bloodwork before starting?

Full hormone + metabolic panels from Anabolic Insights. Code CHONCH for first-order discount.

Order Bloodwork

04Dosing

Free with email

Exenatide dosage and protocols

Dose range: 5 to 10 mcg twice daily (Byetta, immediate-release) or 2000 mcg (2 mg) once weekly (Bydureon, extended-release)
Dosing: Twice daily before meals (immediate-release) or once weekly (extended-release)

Dosing summary

Dose: 5 to 10 mcg twice daily (Byetta, immediate-release) or 2000 mcg (2 mg) once weekly (Bydureon, extended-release)
Route: Subcutaneous injection into the abdomen, thigh, or upper arm; rotate sites
Frequency: Twice daily before meals (immediate-release) or once weekly (extended-release)
Duration: Not cycled. GLP-1 receptor agonists are used as continuous, long-term therapy for as long as they remain clinically beneficial. There is no on/off cycling protocol.

Protocols

Beginner protocol

Reference regimen - immediate-release (Byetta), starting dose. 5 mcg injected subcutaneously twice daily, within 60 minutes before the morning and evening meals (never after a meal). This starter dose is used for roughly the first 4 weeks to let the gut adjust and limit nausea. Rotate injection sites (abdomen, thigh, upper arm). This is a prescription regimen that should only be run under medical supervision; it is presented here for educational, research-use-only reference, not as medical advice.

Intermediate protocol

Reference regimen - immediate-release (Byetta), maintenance dose. After about 4 weeks at 5 mcg, the label dose increases to 10 mcg subcutaneously twice daily, again within 60 minutes before the morning and evening meals. Most of the glucose-lowering and appetite effect is seen at this dose. When exenatide is combined with a sulfonylurea or insulin, the dose of those agents is usually reduced first to limit hypoglycemia. Prescription-only; medical supervision required.

Advanced protocol

Reference regimen - extended-release (Bydureon / Bydureon BCise), once weekly. 2 mg (2000 mcg) injected subcutaneously once every 7 days, at any time of day, with or without food, on the same day each week. Steady-state levels build over about 6 to 7 weeks, so the full effect is delayed. The weekly formulation produced slightly greater HbA1c reductions than twice-daily dosing in the DURATION-1 trial [PMID:18782641], with a lower injection burden, at the cost of more injection-site nodules. Prescription-only; medical supervision required.

Unlock the dosing protocols

Enter your email to keep reading. It is free, and it opens these sections on every compound page in this browser.

Dose, route, how often and how long
Beginner, intermediate and advanced protocols

You also get the free peptide cheat sheet by email. Unsubscribe anytime.

Have an account? Sign in

05Prices

Exenatide prices

No listings

We do not track a vendor for Exenatide yet, so this page states no price.

06Chemistry

Chemistry and structure

Molecular mass: 4186.6 g/mol (molecular formula C184H282N50O60S)
Amino acid sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS (39 amino acids, C-terminally amidated; synthetic exendin-4)
Half-life: Immediate-release (Byetta): terminal half-life about 2.4 hours, cleared mainly by the kidneys. Extended-release (Bydureon): the same peptide is released slowly from biodegradable microspheres over roughly 10 weeks, reaching steady-state plasma levels by about 6 to 7 weeks.

08Questions

Frequently asked questions

What is exenatide and where does it come from?

Exenatide is a synthetic copy of exendin-4, a peptide first found in the saliva of the Gila monster. It is a GLP-1 receptor agonist sold as Byetta (twice daily) and Bydureon (once weekly).

Is exenatide FDA-approved?

Yes, for type 2 diabetes. Byetta was approved in 2005 and the extended-release Bydureon in 2012. It is not FDA-approved for weight loss or for use in people without diabetes.

What is the difference between Byetta and Bydureon?

Both contain the same molecule. Byetta is immediate-release and injected twice daily within 60 minutes before meals. Bydureon is an extended-release microsphere formulation injected just once a week.

How much weight can you lose on exenatide?

In diabetes trials, weight loss averaged about 2 to 3 kg. In non-diabetic adults with obesity, a randomized trial found it reduced food intake but the weight difference versus placebo was not statistically significant at 24 weeks [PMID:29596853]. Its weight effect is weaker than semaglutide or tirzepatide.

How does exenatide compare with semaglutide and tirzepatide?

In the head-to-head SUSTAIN 3 trial, once-weekly semaglutide beat exenatide extended-release on both blood sugar and weight [PMID:29246950]. Tirzepatide, a newer dual GIP/GLP-1 agonist, is more potent still. Exenatide is older and generally cheaper, but the newer weekly agents are stronger for weight and glucose.

Does exenatide cause low blood sugar?

On its own, rarely, because it mainly stimulates insulin when glucose is high. The risk goes up when it is combined with a sulfonylurea or insulin, so those are often dose-reduced first.

Price check

No vendor listings yet

We do not track a vendor for Exenatide yet.

Compare other compounds

Spec sheet

Exenatide

Half-life: Immediate-release (Byetta): terminal half-life about 2.4 hour...
Molecular weight: 4186.6 g/mol (molecular formula C184H282N50O60S)
Also known as: 2 names

Satiora, GLP-1 Spray

Free 2026 Peptide Cheat Sheet (PDF)

38 compounds and blends: vial sizes, BAC water volumes, dosing ranges and bloodwork markers.

Download Free