--- title: "Larazotide (AT-1001): Dosing & Vendor Prices" description: "Larazotide (AT-1001): dosing protocols, mechanism & side effects. Compare 1 verified vendor prices." lang: en json-ld: | [ { "@context": "https://schema.org", "@type": "BreadcrumbList", "itemListElement": [ { "@type": "ListItem", "position": 1, "name": "Home", "item": "https://www.bodyhackguide.co/" }, { "@type": "ListItem", "position": 2, "name": "Compounds", "item": "https://www.bodyhackguide.co/compare" }, { "@type": "ListItem", "position": 3, "name": "Larazotide (AT-1001)" } ] }, { "@context": "https://schema.org", "@type": "Product", "name": "Larazotide (AT-1001)", "description": "Larazotide is an eight amino acid peptide with the sequence glycine-glycine-valine-leucine-valine-glutamine-proline-glycine, usually supplied as the acetate salt. Its structure derives from a protein secreted by Vibrio cholerae, the zonula occludens toxin, and it was developed as an antagonist at that pathway rather than as an agonist. Alba Therapeutics took it into celiac disease (PMID: 17697209), and it was later developed by 9 Meters Biopharma under the code INN-202 (NCT03569007). It is not approved anywhere. The target is the intestinal tight junction. In celiac disease, gluten peptides reach the lamina propria and trigger an immune response, and increased paracellular permeability is one route by which they get there. Larazotide acts locally in the gut lumen to keep tight junctions closed. Mechanistic work links it to redistribution and rearrangement of tight junction proteins and actin filaments, and more recently to inhibition of myosin light chain kinase, which reduces tension on actin filaments and lets the junction close (PMID: 33881350). Because it works in the lumen and is taken orally, it is not designed to reach the systemic circulation. Animal work supports the barrier mechanism outside celiac disease. In interleukin 10 gene-deficient mice, treatment reduced small intestinal permeability and attenuated colitis, with lower colonic tumor necrosis factor alpha secretion at 17 weeks (PMID: 18829978). In pigs, it induced recovery of ischemia-injured jejunum through repair of tight junctions (PMID: 33886649). Rat studies report reduced intestinal permeability and bacterial translocation in acute pancreatitis (PMID: 38441784) and reduced liver and intestinal damage in acute liver failure (PMID: 34791921). The human record is unusually complete for a compound sold as a research chemical, and it is mixed. A proof of concept study in celiac disease subjects challenged with gluten found no increase in adverse events, no rise in intestinal permeability in the treated group against a 70 percent rise on placebo, and fewer gastrointestinal symptoms (PMID: 17697209). Two gluten-challenge trials in 86 and 184 patients failed to separate from placebo on the lactulose to mannitol permeability ratio, but reported reductions in symptoms and, in the larger trial, lower anti-transglutaminase antibody rises (PMID: 22825365, PMID: 23163616). A 342-patient phase 2b trial in patients who still had symptoms on a gluten-free diet met its primary symptom endpoint at the lowest dose tested and not at higher doses (PMID: 25683116). The phase 3 trial then stopped: NCT03569007 enrolled 307 patients and was terminated in 2022 after a pre-specified interim analysis indicated that the number of additional patients needed to show a significant clinical effect was too large to continue (NCT03569007; sponsor announcement, June 2022). Interest has since moved to other barrier-driven conditions. A phase 2a randomized trial in 12 children with multisystem inflammatory syndrome after COVID-19 reported no larazotide-related adverse events, faster clearance of circulating SARS-CoV-2 spike antigen and faster resolution of gastrointestinal symptoms (PMID: 40737433). A long COVID phase 2a trial has completed (NCT05747534). What is sold as a research chemical capsule is an investigational drug, not an approved medicine.", "url": "https://www.bodyhackguide.co/compound/larazotide", "image": "https://www.bodyhackguide.co/og-image.png", "brand": { "@type": "Brand", "name": "Research Compound" }, "offers": { "@type": "AggregateOffer", "lowPrice": "99.99", "highPrice": "99.99", "priceCurrency": "USD", "offerCount": "1", "availability": "https://schema.org/InStock", "offers": [ { "@type": "Offer", "price": "99.99", "priceCurrency": "USD", "availability": "https://schema.org/InStock", "itemCondition": "https://schema.org/NewCondition", "url": "https://disguisedalpha.com/product/larazotide/?coupon=reddit", "seller": { "@type": "Organization", "name": "Disguised Alpha", "url": "https://disguisedalpha.com/?coupon=reddit" } } ] } }, { "@context": "https://schema.org", "@type": "MedicalWebPage", "name": "Larazotide (AT-1001)", "description": "Larazotide is an eight amino acid peptide with the sequence glycine-glycine-valine-leucine-valine-glutamine-proline-glycine, usually supplied as the acetate salt. Its structure derives from a protein secreted by Vibrio cholerae, the zonula occludens toxin, and it was developed as an antagonist at that pathway rather than as an agonist. Alba Therapeutics took it into celiac disease (PMID: 17697209), and it was later developed by 9 Meters Biopharma under the code INN-202 (NCT03569007). It is not approved anywhere. The target is the intestinal tight junction. In celiac disease, gluten peptides reach the lamina propria and trigger an immune response, and increased paracellular permeability is one route by which they get there. Larazotide acts locally in the gut lumen to keep tight junctions closed. Mechanistic work links it to redistribution and rearrangement of tight junction proteins and actin filaments, and more recently to inhibition of myosin light chain kinase, which reduces tension on actin filaments and lets the junction close (PMID: 33881350). Because it works in the lumen and is taken orally, it is not designed to reach the systemic circulation. Animal work supports the barrier mechanism outside celiac disease. In interleukin 10 gene-deficient mice, treatment reduced small intestinal permeability and attenuated colitis, with lower colonic tumor necrosis factor alpha secretion at 17 weeks (PMID: 18829978). In pigs, it induced recovery of ischemia-injured jejunum through repair of tight junctions (PMID: 33886649). Rat studies report reduced intestinal permeability and bacterial translocation in acute pancreatitis (PMID: 38441784) and reduced liver and intestinal damage in acute liver failure (PMID: 34791921). The human record is unusually complete for a compound sold as a research chemical, and it is mixed. A proof of concept study in celiac disease subjects challenged with gluten found no increase in adverse events, no rise in intestinal permeability in the treated group against a 70 percent rise on placebo, and fewer gastrointestinal symptoms (PMID: 17697209). Two gluten-challenge trials in 86 and 184 patients failed to separate from placebo on the lactulose to mannitol permeability ratio, but reported reductions in symptoms and, in the larger trial, lower anti-transglutaminase antibody rises (PMID: 22825365, PMID: 23163616). A 342-patient phase 2b trial in patients who still had symptoms on a gluten-free diet met its primary symptom endpoint at the lowest dose tested and not at higher doses (PMID: 25683116). The phase 3 trial then stopped: NCT03569007 enrolled 307 patients and was terminated in 2022 after a pre-specified interim analysis indicated that the number of additional patients needed to show a significant clinical effect was too large to continue (NCT03569007; sponsor announcement, June 2022). Interest has since moved to other barrier-driven conditions. A phase 2a randomized trial in 12 children with multisystem inflammatory syndrome after COVID-19 reported no larazotide-related adverse events, faster clearance of circulating SARS-CoV-2 spike antigen and faster resolution of gastrointestinal symptoms (PMID: 40737433). A long COVID phase 2a trial has completed (NCT05747534). What is sold as a research chemical capsule is an investigational drug, not an approved medicine.", "lastReviewed": "2026-09-07T04:48:27.098Z", "url": "https://www.bodyhackguide.co/compound/larazotide", "author": { "@type": "Person", "name": "BioChonch", "url": "https://www.bodyhackguide.co/about", "jobTitle": "Founder & Lead Researcher", "sameAs": [ "https://x.com/bodyhackguide", "https://reddit.com/r/BodyHackGuide", "https://reddit.com/r/BrainHackGuide", "https://reddit.com/r/Biohackingher" ], "worksFor": { "@type": "Organization", "name": "BodyHackGuide", "url": "https://www.bodyhackguide.co" } }, "reviewedBy": { "@type": "Person", "name": "BioChonch", "url": "https://www.bodyhackguide.co/about", "jobTitle": "Founder & Lead Researcher", "sameAs": [ "https://x.com/bodyhackguide", "https://reddit.com/r/BodyHackGuide", "https://reddit.com/r/BrainHackGuide", "https://reddit.com/r/Biohackingher" ], "worksFor": { "@type": "Organization", "name": "BodyHackGuide", "url": "https://www.bodyhackguide.co" } }, "publisher": { "@type": "Organization", "name": "BodyHackGuide", "url": "https://www.bodyhackguide.co" }, "mainContentOfPage": { "@type": "WebPageElement", "cssSelector": "main" }, "about": { "@type": "Drug", "name": "Larazotide (AT-1001)", "alternateName": [ "Larazotide acetate", "AT-1001", "AT1001", "AT-2347", "INN-202" ], "description": "Larazotide is an eight amino acid peptide with the sequence glycine-glycine-valine-leucine-valine-glutamine-proline-glycine, usually supplied as the acetate salt. Its structure derives from a protein secreted by Vibrio cholerae, the zonula occludens toxin, and it was developed as an antagonist at that pathway rather than as an agonist. Alba Therapeutics took it into celiac disease (PMID: 17697209), and it was later developed by 9 Meters Biopharma under the code INN-202 (NCT03569007). It is not approved anywhere. The target is the intestinal tight junction. In celiac disease, gluten peptides reach the lamina propria and trigger an immune response, and increased paracellular permeability is one route by which they get there. Larazotide acts locally in the gut lumen to keep tight junctions closed. Mechanistic work links it to redistribution and rearrangement of tight junction proteins and actin filaments, and more recently to inhibition of myosin light chain kinase, which reduces tension on actin filaments and lets the junction close (PMID: 33881350). Because it works in the lumen and is taken orally, it is not designed to reach the systemic circulation. Animal work supports the barrier mechanism outside celiac disease. In interleukin 10 gene-deficient mice, treatment reduced small intestinal permeability and attenuated colitis, with lower colonic tumor necrosis factor alpha secretion at 17 weeks (PMID: 18829978). In pigs, it induced recovery of ischemia-injured jejunum through repair of tight junctions (PMID: 33886649). Rat studies report reduced intestinal permeability and bacterial translocation in acute pancreatitis (PMID: 38441784) and reduced liver and intestinal damage in acute liver failure (PMID: 34791921). The human record is unusually complete for a compound sold as a research chemical, and it is mixed. A proof of concept study in celiac disease subjects challenged with gluten found no increase in adverse events, no rise in intestinal permeability in the treated group against a 70 percent rise on placebo, and fewer gastrointestinal symptoms (PMID: 17697209). Two gluten-challenge trials in 86 and 184 patients failed to separate from placebo on the lactulose to mannitol permeability ratio, but reported reductions in symptoms and, in the larger trial, lower anti-transglutaminase antibody rises (PMID: 22825365, PMID: 23163616). A 342-patient phase 2b trial in patients who still had symptoms on a gluten-free diet met its primary symptom endpoint at the lowest dose tested and not at higher doses (PMID: 25683116). The phase 3 trial then stopped: NCT03569007 enrolled 307 patients and was terminated in 2022 after a pre-specified interim analysis indicated that the number of additional patients needed to show a significant clinical effect was too large to continue (NCT03569007; sponsor announcement, June 2022). Interest has since moved to other barrier-driven conditions. A phase 2a randomized trial in 12 children with multisystem inflammatory syndrome after COVID-19 reported no larazotide-related adverse events, faster clearance of circulating SARS-CoV-2 spike antigen and faster resolution of gastrointestinal symptoms (PMID: 40737433). A long COVID phase 2a trial has completed (NCT05747534). What is sold as a research chemical capsule is an investigational drug, not an approved medicine.", "activeIngredient": "Larazotide (AT-1001)", "administrationRoute": "Oral", "mechanismOfAction": "Larazotide is a tight junction regulator, described as a zonulin antagonist. Zonulin signaling opens the paracellular space between intestinal epithelial cells; larazotide acts in the gut lumen to block that opening and to promote reassembly of tight junctions, with redistribution of tight junction proteins and actin filaments and inhibition of myosin light chain kinase, which reduces the contractile tension that pulls junctions apart (PMID: 33881350). Cell work shows it promotes tight junction assembly in epithelial cells and prevents the actin rearrangement caused by gliadin (PMID: 22401910, PMID: 26770266). Because the intended action is luminal rather than systemic, the compound is given orally and is not designed for absorption into the bloodstream.", "dosageForm": "capsule", "legalStatus": "Not approved for human use — research chemical", "warning": "For research purposes only. Not for human consumption." } }, { "@context": "https://schema.org", "@type": "FAQPage", "mainEntity": [ { "@type": "Question", "name": "What is Larazotide (AT-1001) used for in research?", "acceptedAnswer": { "@type": "Answer", "text": "Larazotide is an eight amino acid peptide with the sequence glycine-glycine-valine-leucine-valine-glutamine-proline-glycine, usually supplied as the acetate salt. Its structure derives from a protein secreted by Vibrio cholerae, the zonula occludens toxin, and it was developed as an antagonist at that pathway rather than as an agonist. Alba Therapeutics took it into celiac disease (PMID: 17697209), and it was later developed by 9 Meters Biopharma under the code INN-202 (NCT03569007). It is not approved anywhere. The target is the intestinal tight junction. In celiac disease, gluten peptides reach the lamina propria and trigger an immune response, and increased paracellular permeability is one route by which they get there. Larazotide acts locally in the gut lumen to keep tight junctions closed. Mechanistic work links it to redistribution and rearrangement of tight junction proteins and actin filaments, and more recently to inhibition of myosin light chain kinase, which reduces tension on actin filaments and lets the junction close (PMID: 33881350). Because it works in the lumen and is taken orally, it is not designed to reach the systemic circulation. Animal work supports the barrier mechanism outside celiac disease. In interleukin 10 gene-deficient mice, treatment reduced small intestinal permeability and attenuated colitis, with lower colonic tumor necrosis factor alpha secretion at 17 weeks (PMID: 18829978). In pigs, it induced recovery of ischemia-injured jejunum through repair of tight junctions (PMID: 33886649). Rat studies report reduced intestinal permeability and bacterial translocation in acute pancreatitis (PMID: 38441784) and reduced liver and intestinal damage in acute liver failure (PMID: 34791921). The human record is unusually complete for a compound sold as a research chemical, and it is mixed. A proof of concept study in celiac disease subjects challenged with gluten found no increase in adverse events, no rise in intestinal permeability in the treated group against a 70 percent rise on placebo, and fewer gastrointestinal symptoms (PMID: 17697209). Two gluten-challenge trials in 86 and 184 patients failed to separate from placebo on the lactulose to mannitol permeability ratio, but reported reductions in symptoms and, in the larger trial, lower anti-transglutaminase antibody rises (PMID: 22825365, PMID: 23163616). A 342-patient phase 2b trial in patients who still had symptoms on a gluten-free diet met its primary symptom endpoint at the lowest dose tested and not at higher doses (PMID: 25683116). The phase 3 trial then stopped: NCT03569007 enrolled 307 patients and was terminated in 2022 after a pre-specified interim analysis indicated that the number of additional patients needed to show a significant clinical effect was too large to continue (NCT03569007; sponsor announcement, June 2022). Interest has since moved to other barrier-driven conditions. A phase 2a randomized trial in 12 children with multisystem inflammatory syndrome after COVID-19 reported no larazotide-related adverse events, faster clearance of circulating SARS-CoV-2 spike antigen and faster resolution of gastrointestinal symptoms (PMID: 40737433). A long COVID phase 2a trial has completed (NCT05747534). What is sold as a research chemical capsule is an investigational drug, not an approved medicine." } }, { "@type": "Question", "name": "What forms does Larazotide (AT-1001) come in?", "acceptedAnswer": { "@type": "Answer", "text": "Larazotide (AT-1001) is available in capsule form." } }, { "@type": "Question", "name": "How much does Larazotide (AT-1001) cost?", "acceptedAnswer": { "@type": "Answer", "text": "Prices start at $99.99 across 1 verified vendor." } }, { "@type": "Question", "name": "How do I compare Larazotide (AT-1001) vendors?", "acceptedAnswer": { "@type": "Answer", "text": "Compare prices, payment methods, shipping, and COA scores across 1 vendor." } } ] }, { "@context": "https://schema.org", "@type": "Organization", "@id": "https://www.bodyhackguide.co#organization", "name": "BodyHackGuide", "alternateName": "BHG", "url": "https://www.bodyhackguide.co", "logo": { "@type": "ImageObject", "url": "https://www.bodyhackguide.co/logo.png", "width": 512, "height": 512 }, "description": "Evidence-based research reference for peptides and nootropics. 124+ compound profiles, interactive dosing calculators, real-time vendor pricing, and trust-scored vendor reviews scored on a public, reproducible methodology applied to every vendor. BodyHackGuide and BHG Labs share common ownership, and we earn a commission on purchases through our links.", "foundingDate": "2024", "founder": { "@id": "https://www.bodyhackguide.co/about#person" }, "sameAs": [ "https://x.com/bodyhackguide", "https://reddit.com/r/BodyHackGuide", "https://reddit.com/r/BrainHackGuide", "https://reddit.com/r/Biohackingher", "https://discord.gg/Mhq5UdRYBA" ], "knowsAbout": [ "Peptide research", "Nootropic research", "Biohacking", "Compound dosing", "Vendor transparency" ], "publishingPrinciples": "https://www.bodyhackguide.co/editorial-standards", "ethicsPolicy": "https://www.bodyhackguide.co/editorial-standards", "diversityPolicy": "https://www.bodyhackguide.co/editorial-standards" } ] --- [Skip to content](#main-content) ## Research Use Only This site is an **educational resource** for research compounds. We do **not endorse** human consumption of any compound. BodyHackGuide and **BHG Labs share common ownership**; we rank every vendor on the same public methodology, and we earn a commission on purchases through our links. By entering, you confirm you are **21 years of age or older** and agree to our [Terms](/terms) & [Privacy Policy](/privacy). I'm 21+ — Enter SiteLeave site [![BodyHackGuide](/assets/bodyhackguide-logo-DOzZNUyh.webp)BodyHackGuide ](/) [Compare](/compare)[Wiki](/wiki)[Vendors](/vendors)[Deals](/deals)[Stacks](/stack-builder)[Nootropics](/nootropics)[Tools](/tools) Learn Community Search ⌘K [Sign In](/auth?returnTo=%2Fcompound%2Flarazotide) 100K+ researchers trust BodyHackGuide — Join [r/BodyHackGuide](https://reddit.com/r/bodyhackguide) 1. [Home](/) 2. [Compounds](/compare) 3. Larazotide (AT-1001) [Where to buy Larazotide (AT-1001)](/buy/larazotide) [Larazotide (AT-1001) coupon codes](/coupons/larazotide) [Larazotide (AT-1001) protocol](/protocol/larazotide) [Alternatives to Larazotide (AT-1001)](/alternatives-to/larazotide) [Larazotide (AT-1001) side effects](/side-effects/larazotide) 1. [Home](/) 3. [Compounds](/compare) 5. Larazotide (AT-1001) ![Larazotide (AT-1001) molecular structure](/assets/peptide-structure-placeholder-DUmZBF_j.png) # Larazotide (AT-1001) Immune & Inflammation Phase 3 Download PDF Also known as: Larazotide acetate, AT-1001, AT1001, AT-2347, INN-202 Larazotide is an eight amino acid peptide with the sequence glycine-glycine-valine-leucine-valine-glutamine-proline-glycine, usually supplied as the acetate salt. Its structure derives from a protein secreted by Vibrio cholerae, the zonula occludens toxin, and it was developed as an antagonist at that pathway rather than as an agonist. Half-Life: Not established as a systemic value. Larazotide is designed to act locally in the intestinal lumen and is given orally rather than for systemic exposure (PMID: 33881350); single-dose safety, tolerance and pharmacokinetics were assessed in a phase 1b study in celiac disease subjects (PMID: 17697209) Route: Oral MW: 725.85 g/mol (free peptide); 785.9 g/mol as the acetate salt CAS: 258818-34-7 Last reviewed: Sep 7, 2026 [ Immune & Inflammation Category ](/wiki#cat-immune-&-inflammation) Phase 3 Research Stage OverviewChemical InfoDosing & ProtocolsInteractionsResearchCompare Prices1 Related ## Overview ### Best Price Available ![Disguised Alpha logo](https://disguisedalpha.com/wp-content/themes/assets/logos/disguised-logo-2x.png) Disguised Alpha $99.99 60 capsules · capsule [Buy Now](https://disguisedalpha.com/product/larazotide/?coupon=reddit) Compare 1 vendor ### At A Glance Mechanism Larazotide is a tight junction regulator, described as a zonulin antagonist. Zonulin signaling opens the paracellular space between intestinal epithelial cells; larazotide acts in the gut lumen to block that opening and to promote reassembly of tight junctions, with redistributio… Half-Life Not established as a systemic value. Larazotide is designed to act locally in the intestinal lumen and is given orally rather than for systemic exposure (PMID: 33881350); single-dose safety, tolerance and pharmacokinetics were assessed in a phase 1b study in celiac disease subjects (PMID: 17697209) Routes Oral Potential Benefits Prevented the gluten-induced rise in intestinal permeability seen on placebo and reduced gastrointestinal symptoms in adults with celiac disease in a phase 1b proof of concept study (PMID: 17697209) Reduced gluten-induced symptom severity and anti-transglutaminase antibody rises in adults with celiac disease undergoing gluten challenge in a 184-patient randomized trial (PMID: 23163616) Met the primary symptom endpoint at the lowest dose tested in 342 adults with celiac disease who still had symptoms on a gluten-free diet (PMID: 25683116) Reduced small intestinal permeability and attenuated colitis in interleukin 10 gene-deficient mice (PMID: 18829978) Promoted recovery of ischemia-injured jejunum through tight junction repair in pigs (PMID: 33886649) Faster clearance of circulating SARS-CoV-2 spike antigen and faster resolution of gastrointestinal symptoms in 12 children with multisystem inflammatory syndrome in a phase 2a trial (PMID: 40737433) ### Overview Larazotide is an eight amino acid peptide with the sequence glycine-glycine-valine-leucine-valine-glutamine-proline-glycine, usually supplied as the acetate salt. Its structure derives from a protein secreted by Vibrio cholerae, the zonula occludens toxin, and it was developed as an antagonist at that pathway rather than as an agonist. Alba Therapeutics took it into celiac disease (PMID: 17697209), and it was later developed by 9 Meters Biopharma under the code INN-202 (NCT03569007). It is not approved anywhere. The target is the intestinal tight junction. In celiac disease, gluten peptides reach the lamina propria and trigger an immune response, and increased paracellular permeability is one route by which they get there. Larazotide acts locally in the gut lumen to keep tight junctions closed. Mechanistic work links it to redistribution and rearrangement of tight junction proteins and actin filaments, and more recently to inhibition of myosin light chain kinase, which reduces tension on actin filaments and lets the junction close (PMID: 33881350). Because it works in the lumen and is taken orally, it is not designed to reach the systemic circulation. Animal work supports the barrier mechanism outside celiac disease. In interleukin 10 gene-deficient mice, treatment reduced small intestinal permeability and attenuated colitis, with lower colonic tumor necrosis factor alpha secretion at 17 weeks (PMID: 18829978). In pigs, it induced recovery of ischemia-injured jejunum through repair of tight junctions (PMID: 33886649). Rat studies report reduced intestinal permeability and bacterial translocation in acute pancreatitis (PMID: 38441784) and reduced liver and intestinal damage in acute liver failure (PMID: 34791921). The human record is unusually complete for a compound sold as a research chemical, and it is mixed. A proof of concept study in celiac disease subjects challenged with gluten found no increase in adverse events, no rise in intestinal permeability in the treated group against a 70 percent rise on placebo, and fewer gastrointestinal symptoms (PMID: 17697209). Two gluten-challenge trials in 86 and 184 patients failed to separate from placebo on the lactulose to mannitol permeability ratio, but reported reductions in symptoms and, in the larger trial, lower anti-transglutaminase antibody rises (PMID: 22825365, PMID: 23163616). A 342-patient phase 2b trial in patients who still had symptoms on a gluten-free diet met its primary symptom endpoint at the lowest dose tested and not at higher doses (PMID: 25683116). The phase 3 trial then stopped: NCT03569007 enrolled 307 patients and was terminated in 2022 after a pre-specified interim analysis indicated that the number of additional patients needed to show a significant clinical effect was too large to continue (NCT03569007; sponsor announcement, June 2022). Interest has since moved to other barrier-driven conditions. A phase 2a randomized trial in 12 children with multisystem inflammatory syndrome after COVID-19 reported no larazotide-related adverse events, faster clearance of circulating SARS-CoV-2 spike antigen and faster resolution of gastrointestinal symptoms (PMID: 40737433). A long COVID phase 2a trial has completed (NCT05747534). What is sold as a research chemical capsule is an investigational drug, not an approved medicine. ### Potential Research Fields Intestinal barrier function Celiac disease Tight junction pharmacology Post-viral inflammatory syndromes ## Chemical Information IUPAC Name Not yet available CAS Number 258818-34-7 Molecular Formula C32H55N9O10 Molecular Mass 725.85 g/mol (free peptide) ![Larazotide (AT-1001) molecular structure](https://pubchem.ncbi.nlm.nih.gov/rest/pug/compound/cid/9810532/PNG) [View on PubChem](https://pubchem.ncbi.nlm.nih.gov/compound/9810532) ## Dosing & Protocols ### Unlock Dosing Protocols Free account gets you: - View beginner, intermediate & advanced protocols - See weight-based dosing calculations - Access cycle length & frequency data [Create free account](/auth)[Sign in](/auth) 2,800+ researchers already in ## Research ### Unlock Research Data Free account gets you: - Browse PubMed study summaries - See clinical trial phases & results - Access mechanism of action details [Create free account](/auth)[Sign in](/auth) 2,800+ researchers already in ## Interactions ### Contraindications No pharmacological contraindications have been established in the published trials. Mechanism-based caution: larazotide does not treat celiac disease and does not make gluten safe to eat. In every trial, patients stayed on a gluten-free diet or were given a controlled gluten challenge under supervision, and the compound was studied as an addition to the diet, not a replacement for it (PMID: 25683116). Trial exclusion criteria in the phase 3 study covered refractory celiac disease, severe complications of celiac disease and chronic active gastrointestinal disease other than celiac disease (NCT03569007). Research Disclaimer This interaction data is compiled from published research and community reports. It may not be exhaustive. Always consult a healthcare professional before combining compounds. Best Price $99.99 Best $/mg — Vendors 1 Listings 1 capsule [Sign in for alerts ](/auth) Form Allcapsule Sort Price $/mg Vendor Vendor Product Form Qty Price $/mg Coupon ![Disguised Alpha logo](https://disguisedalpha.com/wp-content/themes/assets/logos/disguised-logo-2x.png) [Disguised Alpha](/vendor/disguised-alpha) [50 ](/vendor-trust-scorecard) 🇺🇸 US 🇪🇺 EU 🇬🇧 UK Larazotide capsules (60) capsule 60 capsules ● In Stock $99.99 BEST — — [Buy](https://disguisedalpha.com/product/larazotide/?coupon=reddit) Get Larazotide (AT-1001) Price Drop Alerts Set a target price and we'll notify you when any vendor drops below it. Current lowest: $99.99 [Sign in to set alerts](/auth) ### Sign in to leave a review Reviews on BodyHackGuide are tied to verified user accounts and moderated before publishing. Sign in (free, no spam) to share your experience with Larazotide (AT-1001). [Sign in](/auth) Current low $99.99 as of Sep 7, 2026 7-day low $99.99 30-day low $99.99 30-day change — baseline building Tracking since Sep 7, 2026 · 1 data point ### Vendors Selling Larazotide (AT-1001) [ ![Disguised Alpha logo](https://disguisedalpha.com/wp-content/themes/assets/logos/disguised-logo-2x.png) #### Disguised Alpha 1 listing · from $99.99 ](/vendor/disguised-alpha) How we score these vendors Every supplier above is graded 0–100 on COA verification, payment transparency, shipping, reviews, and active listings. Methodology published, no pay-to-rank. [View Scorecard](/vendors/scorecard) ### Related Compounds [View All](/wiki) [ ### LL-37 Immune & Inflammation Phase 2 LL-37 is the only human cathelicidin, a 37-amino-acid amphipathic alpha-helical peptide ([LL-37, 37 aa]) cleaved from the C-terminus of the 170-amino-acid precursor hCAP-18 (human cationic antimicrobial protein, 18 kDa), which is encoded by the CAMP gene on chromosome 3p21.31. t½ ~30 minutes (free peptide; rapidly cleared by proteolysis). Human pharmacokinetics of exogenous LL-37 are not well characterized. 3029 studies View Profile ](/compound/ll-37)[ ### Thymosin Alpha-1 (TA1) Immune & Inflammation FDA Approved Thymosin alpha-1 (Tα1) is a 28-amino-acid N-acetylated peptide (N-Ac-Ser-Asp-Ala-Ala-Val-Asp-Thr-Ser-Ser-Glu-Ile-Thr-Thr-Lys-Asp-Leu-Lys-Glu-Lys-Lys-Glu-Val-Val-Glu-Glu-Ala-Glu-Asn) isolated and characterized by Allan Goldstein's laboratory at George Washington University in the 1970s as the immunologically active cleavage product of a larger precursor (prothymosin alpha) found in thymic tissue. t½ ~2 hours 1,600 mcg (1.6 mg) per injection (standard clinical dose) 701 studies View Profile ](/compound/thymosin-alpha-1) [ View Full Dosage Guide → Protocols, calculator & safety for Larazotide (AT-1001) ](/guides/dosage/larazotide) ### Best Price ![Disguised Alpha logo](https://disguisedalpha.com/wp-content/themes/assets/logos/disguised-logo-2x.png) Disguised Alpha $99.99 [Buy Now](https://disguisedalpha.com/product/larazotide/?coupon=reddit) 1 vendors · 1 listings ### Research Score 30 0 PubMed studies ### Quality Indicators Data Completeness 63% Description Mechanism of Action Chemical Data Dosing Protocols Safety Profile PubMed Studies Interactions Vendor Listings ### Quick Facts Half-Life Not established as a systemic value. Larazotide is designed to act locally in the intestinal lumen and is given orally rather than for systemic exposure (PMID: 33881350); single-dose safety, tolerance and pharmacokinetics were assessed in a phase 1b study in celiac disease subjects (PMID: 17697209) Molecular Weight 725.85 g/mol (free peptide) Administration Oral CAS Number 258818-34-7 Trial Phase Phase 3 0 [Full Dosage Guide](/guides/dosage/larazotide)[Calculate Your Dose](/tools/reconstitution) Research Disclaimer This information is for educational and research purposes only. Not intended as medical advice. Consult a healthcare professional before use. ## Frequently Asked Questions What is Larazotide (AT-1001) used for in research? Larazotide is an eight amino acid peptide with the sequence glycine-glycine-valine-leucine-valine-glutamine-proline-glycine, usually supplied as the acetate salt. Its structure derives from a protein secreted by Vibrio cholerae, the zonula occludens toxin, and it was developed as an antagonist at that pathway rather than as an agonist. Alba Therapeutics took it into celiac disease (PMID: 17697209), and it was later developed by 9 Meters Biopharma under the code INN-202 (NCT03569007). It is not approved anywhere. The target is the intestinal tight junction. In celiac disease, gluten peptides reach the lamina propria and trigger an immune response, and increased paracellular permeability is one route by which they get there. Larazotide acts locally in the gut lumen to keep tight junctions closed. Mechanistic work links it to redistribution and rearrangement of tight junction proteins and actin filaments, and more recently to inhibition of myosin light chain kinase, which reduces tension on actin filaments and lets the junction close (PMID: 33881350). Because it works in the lumen and is taken orally, it is not designed to reach the systemic circulation. Animal work supports the barrier mechanism outside celiac disease. In interleukin 10 gene-deficient mice, treatment reduced small intestinal permeability and attenuated colitis, with lower colonic tumor necrosis factor alpha secretion at 17 weeks (PMID: 18829978). In pigs, it induced recovery of ischemia-injured jejunum through repair of tight junctions (PMID: 33886649). Rat studies report reduced intestinal permeability and bacterial translocation in acute pancreatitis (PMID: 38441784) and reduced liver and intestinal damage in acute liver failure (PMID: 34791921). The human record is unusually complete for a compound sold as a research chemical, and it is mixed. A proof of concept study in celiac disease subjects challenged with gluten found no increase in adverse events, no rise in intestinal permeability in the treated group against a 70 percent rise on placebo, and fewer gastrointestinal symptoms (PMID: 17697209). Two gluten-challenge trials in 86 and 184 patients failed to separate from placebo on the lactulose to mannitol permeability ratio, but reported reductions in symptoms and, in the larger trial, lower anti-transglutaminase antibody rises (PMID: 22825365, PMID: 23163616). A 342-patient phase 2b trial in patients who still had symptoms on a gluten-free diet met its primary symptom endpoint at the lowest dose tested and not at higher doses (PMID: 25683116). The phase 3 trial then stopped: NCT03569007 enrolled 307 patients and was terminated in 2022 after a pre-specified interim analysis indicated that the number of additional patients needed to show a significant clinical effect was too large to continue (NCT03569007; sponsor announcement, June 2022). Interest has since moved to other barrier-driven conditions. A phase 2a randomized trial in 12 children with multisystem inflammatory syndrome after COVID-19 reported no larazotide-related adverse events, faster clearance of circulating SARS-CoV-2 spike antigen and faster resolution of gastrointestinal symptoms (PMID: 40737433). A long COVID phase 2a trial has completed (NCT05747534). What is sold as a research chemical capsule is an investigational drug, not an approved medicine. What forms does Larazotide (AT-1001) come in? Larazotide (AT-1001) is available in capsule form. How much does Larazotide (AT-1001) cost? Prices start at $99.99 across 1 verified vendor. How do I compare Larazotide (AT-1001) vendors? Compare prices, payment methods, shipping, and COA scores across 1 vendor. ## Research Tools [ ### Peptide Calculator Reconstitution & syringe units ](/tools/reconstitution)[ ### Reconstitution Guide How to mix, step by step ](/guides/how-to-reconstitute-peptides)[ ### Nasal Spray Calc mL per actuation ](/tools/intranasal)[ ### Half-Life Visualizer Decay curves ](/tools/halflife) ## Related Compounds [View All](/wiki) [ ### LL-37 Immune & Inflammation Phase 2 LL-37 is the only human cathelicidin, a 37-amino-acid amphipathic alpha-helical peptide ([LL-37, 37 aa]) cleaved from the C-terminus of the 170-amino-acid precursor hCAP-18 (human cationic antimicrobial protein, 18 kDa), which is encoded by the CAMP gene on chromosome 3p21.31. t½ ~30 minutes (free peptide; rapidly cleared by proteolysis). Human pharmacokinetics of exogenous LL-37 are not well characterized. 3029 studies View Profile ](/compound/ll-37)[ ### Thymosin Alpha-1 (TA1) Immune & Inflammation FDA Approved Thymosin alpha-1 (Tα1) is a 28-amino-acid N-acetylated peptide (N-Ac-Ser-Asp-Ala-Ala-Val-Asp-Thr-Ser-Ser-Glu-Ile-Thr-Thr-Lys-Asp-Leu-Lys-Glu-Lys-Lys-Glu-Val-Val-Glu-Glu-Ala-Glu-Asn) isolated and characterized by Allan Goldstein's laboratory at George Washington University in the 1970s as the immunologically active cleavage product of a larger precursor (prothymosin alpha) found in thymic tissue. t½ ~2 hours 1,600 mcg (1.6 mg) per injection (standard clinical dose) 701 studies View Profile ](/compound/thymosin-alpha-1) Free 2026 Peptide Cheat Sheet — 50 pages, PDF Reconstitution math, concentration charts, half-lives, and vendor trust tiers. The reference we wish we had on day one. [Download Free](/guides/peptide-cheat-sheet-download?utm_source=compound-larazotide) ### Need bloodwork before starting? Full hormone + metabolic panels from Anabolic Insights. Code CHONCH for first-order discount. [Order Bloodwork](https://anabolicinsights.ai/?ref=nwm2zjb) ![BodyHackGuide](/assets/bodyhackguide-logo-DOzZNUyh.webp) ### BodyHackGuide Your biohacking research hub — compound pricing, brain health protocols, dosing tools, and vendor reviews. [support@bodyhackguide.co](mailto:support@bodyhackguide.co) [](https://discord.gg/Mhq5UdRYBA)[](https://reddit.com/r/BodyHackGuide)[](https://x.com/bodyhackguide) Explore #### Explore - [Compare prices](/compare) - [Research suppliers](/vendors) - [Deals](/deals) - [Coupons](/coupons) - [Nootropics](/nootropics) - [Brain health](/brain-health) - [Blog](/blog) - [Guides](/guides) Tools #### Tools - [Reconstitution](/tools/reconstitution) - [Dosage calculator](/tools/dosage) - [Half-life visualizer](/tools/halflife) - [COA lookup](/tools/coa) - [Cost calculator](/tools/cost-calculator) - [Stack builder](/stack-builder) - [All tools →](/tools) Trust & vendors #### Trust & vendors - [Vendor directory](/vendors) - [Trust scorecard](/vendors/scorecard) - [Get BHG verified](/vendors/get-vetted) - [Scoring methodology](/vendors/methodology) - [Peptide cheatsheet](/guides/peptide-cheat-sheet-download) Company #### Company - [About](/about) - [Affiliate disclosure](/affiliate-disclosure) - [Editorial standards](/editorial-standards) - [Creators](/creators) - [Coaches](/coaches) - [Privacy](/privacy) - [Terms](/terms) - [Full site directory →](/site-directory) **Ownership & Affiliate Disclosure:** BodyHackGuide and BHG Labs share common ownership. We rank every vendor on the same public, reproducible [methodology](/vendors/methodology), and we earn a commission from purchases made through our links at no extra cost to you. Full details in our [affiliate disclosure](/affiliate-disclosure). **Research Disclaimer:** All compounds listed are for laboratory and research purposes only. Not for human consumption. This site does not sell, distribute, or promote any products. Always consult a qualified healthcare professional and comply with local regulations. © 2026 BodyHackGuide. All rights reserved. · [Terms](/terms) · [Privacy](/privacy) hi 👋