--- title: "Exenatide: Dosage & Side Effects | BodyHackGuide" url: https://www.bodyhackguide.co/compound/exenatide description: "Exenatide: dosing protocols, mechanism & side effects." lang: en --- Skip to content Compare notes on r/BodyHackGuide (https://reddit.com/r/bodyhackguide) Compare notes with other researchers. Join r/BodyHackGuide (https://reddit.com/r/bodyhackguide) # Exenatide Weight Loss: https://www.bodyhackguide.co/wiki#cat-weight-loss Status FDA-approved Evidence Not graded on a research bench yet Exenatide (Byetta, Bydureon) is a synthetic exendin-4 GLP-1 receptor agonist, FDA-approved for type 2 diabetes, that lowers blood glucose and curbs appetite. Reviewed 28 October 2026 01 Overview ## What Exenatide is Available as a twice-daily immediate-release and a once-weekly extended-release injection. ### How it works Exenatide is a synthetic form of exendin-4, a 39-amino-acid peptide first isolated from the saliva of the Gila monster (Heloderma suspectum). It shares about 53 percent of its sequence with human GLP-1 but, unlike native GLP-1, resists breakdown by the DPP-4 enzyme, so it stays active far longer. Read the full mechanism Show less As a GLP-1 receptor agonist it works through several complementary mechanisms: - Glucose-dependent insulin release: it prompts the pancreatic beta cells to secrete insulin mainly when blood glucose is elevated, which keeps hypoglycemia risk low when it is used on its own. - Glucagon suppression: it lowers inappropriately high glucagon output from the alpha cells, reducing the liver's glucose production. - Slowed gastric emptying: food leaves the stomach more slowly, blunting post-meal glucose spikes and prolonging fullness. - Appetite and satiety: it acts on central appetite centers to reduce hunger and food intake, which drives the weight loss seen in trials. The immediate-release version (Byetta) is cleared quickly and given twice daily before meals. The extended-release version (Bydureon) uses biodegradable microspheres that release the same molecule slowly over weeks, allowing once-weekly dosing. ### Benefits listed - Meaningful glycemic control in type 2 diabetes, with HbA1c reductions of roughly 1.0 to 1.9 percent in randomized trials - Weight reduction of about 2 to 3 kg in diabetic trials, driven mainly by reduced appetite and slower gastric emptying - Low intrinsic hypoglycemia risk because insulin release is glucose-dependent (risk rises when combined with sulfonylureas or insulin) - Strong control of post-meal glucose spikes Show 4 more Show less - Cardiovascular safety shown in a large outcomes trial, with no increase in major cardiac events - Can be added to basal insulin to improve control while offsetting insulin-related weight gain - Once-weekly extended-release option (Bydureon) reduces injection burden versus twice-daily dosing - In people without diabetes the appetite effect is real, but standalone weight loss has been modest and less consistent than newer agents such as [semaglutide](/compound/semaglutide) or [tirzepatide](/compound/tirzepatide) ### What to expect 1. - First 1 to 4 weeks: nausea and reduced appetite are common while the body adjusts; the low 5 mcg starter dose is used to ease this in 2. - Weeks 4 to 8: on the full dose, appetite suppression and post-meal glucose control are most noticeable and early weight loss begins 3. - For the once-weekly extended-release form, blood levels and full effect build gradually over about 6 to 7 weeks 4. - Gastrointestinal side effects usually lessen over time; small injection-site nodules can appear with the weekly form 5. - Weight and glucose effects are modest compared with newer agents such as [semaglutide](/compound/semaglutide) or [tirzepatide](/compound/tirzepatide) Individual responses vary. Timeline based on commonly reported research observations. 02 Research Free with email ## What the research shows No research bench grades Exenatide yet. Benches compare compounds people pair, with the evidence for each. ### Unlock the research summary Enter your email to keep reading. It is free, and it opens these sections on every compound page in this browser. - A summary of the key research - Safety and side effects - A link to the PubMed results You also get the free peptide cheat sheet by email. Unsubscribe anytime. Have an account? Sign in (https://www.bodyhackguide.co/auth) 03 Safety ## Exenatide side effects and interactions ### Side effects Not in our record Our record lists no side effects for Exenatide. That means none are recorded here, not that there are none. The Research section has the written safety notes. ### Who should not use it Contraindications Do not use with a personal or family history of medullary thyroid carcinoma or Multiple Endocrine Neoplasia syndrome type 2 (boxed warning for the extended-release form). Contraindicated after any prior serious hypersensitivity reaction to exenatide. Not recommended in severe renal impairment (creatinine clearance under 30 mL/min) or end-stage renal disease, because clearance is kidney-dependent. Use caution or avoid with a history of pancreatitis, severe gastrointestinal disease, or gastroparesis. Exenatide does not treat type 1 diabetes or diabetic ketoacidosis. It is not recommended in pregnancy or breastfeeding, and it is not FDA-approved for weight loss or for use in people without diabetes. ### Interactions 4 pairings in our record: 4 not rated. - Not rated Sulfonylureas and insulin: additive hypoglycemia risk, so these are often dose-reduced when exenatide is started - Not rated Oral drugs that need precise timing (some antibiotics, oral contraceptives): slowed gastric emptying can delay their absorption, so take them at least 1 hour before an exenatide injection - Not rated Warfarin: rare reports of increased INR; monitor when starting - Not rated Other GLP-1 receptor agonists or DPP-4 inhibitors: should not be combined because of overlapping mechanism This interaction data is compiled from published research and community reports. It may not be exhaustive. Always consult a healthcare professional before combining compounds. Need bloodwork before starting? Full hormone + metabolic panels from Anabolic Insights. Code CHONCH for first-order discount. Order Bloodwork (https://anabolicinsights.ai/?ref=nwm2zjb) 04 Dosing Free with email ## Exenatide dosage and protocols Dose range 5 to 10 mcg twice daily (Byetta, immediate-release) or 2000 mcg (2 mg) once weekly (Bydureon, extended-release) Dosing Twice daily before meals (immediate-release) or once weekly (extended-release) ### Unlock the dosing protocols - Dose, route, how often and how long - Beginner, intermediate and advanced protocols 05 Prices ## Exenatide prices No listings We do not track a vendor for Exenatide yet, so this page states no price. 06 Chemistry ## Chemistry and structure Molecular mass 4186.6 g/mol (molecular formula C184H282N50O60S) Amino acid sequence HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS (39 amino acids, C-terminally amidated; synthetic exendin-4) Half-life Immediate-release (Byetta): terminal half-life about 2.4 hours, cleared mainly by the kidneys. Extended-release (Bydureon): the same peptide is released slowly from biodegradable microspheres over roughly 10 weeks, reaching steady-state plasma levels by about 6 to 7 weeks. 07 Related ## Related to Exenatide ### In the same category - 5-Amino-1MQPreclinical 5-Amino-1MQ (5-amino-1-methylquinolinium iodide) is a small-molecule inhibitor of nicotinamide N-methyltransferase (NNMT), an enzyme that transfers a methyl group from S-adenosyl-L-methionine (SAM) to nicotinamide to form 1-methylnicotinamide (1-MNA) and S-adenosyl-L-homocysteine (SAH).: https://www.bodyhackguide.co/compound/5-amino-1mq - AdipotidePhase 1 Adipotide is an experimental chimeric peptide that joins a white-fat-homing motif to a cell-killing motif, developed in the laboratory of Wadih Arap and Renata Pasqualini to destroy the blood supply of white adipose tissue.: https://www.bodyhackguide.co/compound/adipotide - BAM15Preclinical BAM15 is a small-molecule mitochondrial protonophore uncoupler that was first described in 2014 as a tool compound for dissipating proton motive force selectively across the inner mitochondrial membrane without collapsing the plasma membrane electrochemical gradient.: https://www.bodyhackguide.co/compound/bam15 - Eloralintide (LY3841136)Phase 3 Eloralintide is an amylin analog developed by Eli Lilly and Company for weight management, given as a once-weekly subcutaneous injection.: https://www.bodyhackguide.co/compound/eloralintide - L-CarnitineDietary Supplement L-Carnitine is a naturally occurring quaternary ammonium compound synthesized in the body from the amino acids lysine and methionine, with essential cofactor roles in fatty acid metabolism, energy production, and cellular health.: https://www.bodyhackguide.co/compound/l-carnitine - Lipo-CNo clinical trials of the blend Lipo-C (also sold as a MIC or "lipotropic" injection) is a compounded blend of methionine, inositol, and choline, usually with vitamin B12 and sometimes L-carnitine, marketed by medspas and weight-loss clinics to support fat metabolism and energy.: https://www.bodyhackguide.co/compound/lipo-c All compounds (https://www.bodyhackguide.co/wiki) ### Compare Exenatide - Alternatives to Exenatide: https://www.bodyhackguide.co/alternatives-to/exenatide ### Research tools - Peptide Calculator Reconstitution and syringe units: https://www.bodyhackguide.co/tools/reconstitution - Reconstitution Guide How to mix, step by step: https://www.bodyhackguide.co/guides/how-to-reconstitute-peptides - Nasal Spray Calc mL per actuation: https://www.bodyhackguide.co/tools/intranasal - Half-Life Visualizer Decay curves: https://www.bodyhackguide.co/tools/halflife All articles (https://www.bodyhackguide.co/blog) 08 Questions ## Frequently asked questions What is exenatide and where does it come from? Exenatide is a synthetic copy of exendin-4, a peptide first found in the saliva of the Gila monster. It is a GLP-1 receptor agonist sold as Byetta (twice daily) and Bydureon (once weekly). Is exenatide FDA-approved? Yes, for type 2 diabetes. Byetta was approved in 2005 and the extended-release Bydureon in 2012. It is not FDA-approved for weight loss or for use in people without diabetes. What is the difference between Byetta and Bydureon? Both contain the same molecule. Byetta is immediate-release and injected twice daily within 60 minutes before meals. Bydureon is an extended-release microsphere formulation injected just once a week. How much weight can you lose on exenatide? In diabetes trials, weight loss averaged about 2 to 3 kg. In non-diabetic adults with obesity, a randomized trial found it reduced food intake but the weight difference versus placebo was not statistically significant at 24 weeks [PMID:29596853]. Its weight effect is weaker than semaglutide (https://www.bodyhackguide.co/compound/semaglutide) or tirzepatide (https://www.bodyhackguide.co/compound/tirzepatide). How does exenatide compare with semaglutide and tirzepatide? In the head-to-head SUSTAIN 3 trial, once-weekly semaglutide beat exenatide extended-release on both blood sugar and weight [PMID:29246950]. Tirzepatide, a newer dual GIP/GLP-1 agonist, is more potent still. Exenatide is older and generally cheaper, but the newer weekly agents are stronger for weight and glucose. Does exenatide cause low blood sugar? On its own, rarely, because it mainly stimulates insulin when glucose is high. The risk goes up when it is combined with a sulfonylurea or insulin, so those are often dose-reduced first. Free 2026 Peptide Cheat Sheet (PDF) 38 compounds and blends: vial sizes, BAC water volumes, dosing ranges and bloodwork markers. Download Free (https://www.bodyhackguide.co/guides/peptide-cheat-sheet-download) BodyHackGuide (https://www.bodyhackguide.co/) Your biohacking research hub: compound pricing, brain health protocols, dosing tools, and vendor reviews. support@bodyhackguide.co Join our Discord: https://discord.gg/Mhq5UdRYBA r/BodyHackGuide on Reddit: https://reddit.com/r/BodyHackGuide **Affiliate Disclosure:** We rank every vendor on the same public, reproducible methodology (https://www.bodyhackguide.co/vendors/methodology). Full details in our affiliate disclosure (https://www.bodyhackguide.co/affiliate-disclosure). **Research Disclaimer:** All compounds listed are for laboratory and research purposes only. Not for human consumption. This site does not sell or ship any products. Always consult a qualified healthcare professional and comply with local regulations. © 2026 BodyHackGuide. All rights reserved. - Terms: https://www.bodyhackguide.co/terms - Privacy: https://www.bodyhackguide.co/privacy ## Structured data ```json [ { "@context": "https://schema.org", "@type": "BreadcrumbList", "itemListElement": [ { "@type": "ListItem", "position": 1, "name": "Home", "item": "https://www.bodyhackguide.co/" }, { "@type": "ListItem", "position": 2, "name": "Compounds", "item": "https://www.bodyhackguide.co/compare" }, { "@type": "ListItem", "position": 3, "name": "Exenatide" } ] }, { "@context": "https://schema.org", "@type": "MedicalWebPage", "name": "Exenatide", "description": "Exenatide (Byetta, Bydureon) is a synthetic exendin-4 GLP-1 receptor agonist, FDA-approved for type 2 diabetes, that lowers blood glucose and curbs appetite. Available as a twice-daily immediate-release and a once-weekly extended-release injection.", "lastReviewed": "2026-10-28T22:24:04.826Z", "url": "https://www.bodyhackguide.co/compound/exenatide", "author": { "@type": "Person", "name": "BioChonch", "url": "https://www.bodyhackguide.co/about", "jobTitle": "Founder & Lead Researcher", "sameAs": [ "https://reddit.com/r/BodyHackGuide", "https://reddit.com/r/BrainHackGuide", "https://reddit.com/r/Biohackingher" ], "worksFor": { "@type": "Organization", "name": "BodyHackGuide", "url": "https://www.bodyhackguide.co" } }, "reviewedBy": { "@type": "Person", "name": "BioChonch", "url": "https://www.bodyhackguide.co/about", "jobTitle": "Founder & Lead Researcher", "sameAs": [ "https://reddit.com/r/BodyHackGuide", "https://reddit.com/r/BrainHackGuide", "https://reddit.com/r/Biohackingher" ], "worksFor": { "@type": "Organization", "name": "BodyHackGuide", "url": "https://www.bodyhackguide.co" } }, "publisher": { "@type": "Organization", "name": "BodyHackGuide", "url": "https://www.bodyhackguide.co" }, "mainContentOfPage": { "@type": "WebPageElement", "cssSelector": "main" }, "about": { "@type": "Drug", "name": "Exenatide", "alternateName": [ "Satiora", "GLP-1 Spray" ], "description": "Exenatide (Byetta, Bydureon) is a synthetic exendin-4 GLP-1 receptor agonist, FDA-approved for type 2 diabetes, that lowers blood glucose and curbs appetite. Available as a twice-daily immediate-release and a once-weekly extended-release injection.", "activeIngredient": "Exenatide", "mechanismOfAction": "Exenatide is a synthetic form of exendin-4, a 39-amino-acid peptide first isolated from the saliva of the Gila monster (Heloderma suspectum). It shares about 53 percent of its sequence with human GLP-1 but, unlike native GLP-1, resists breakdown by the DPP-4 enzyme, so it stays active far longer. As a GLP-1 receptor agonist it works through several complementary mechanisms: Glucose-dependent insulin release: it prompts the pancreatic beta cells to secrete insulin mainly when blood glucose is elevated, which keeps hypoglycemia risk low when it is used on its own. Glucagon suppression: it lowers inappropriately high glucagon output from the alpha cells, reducing the liver's glucose production. Slowed gastric emptying: food leaves the stomach more slowly, blunting post-meal glucose spikes and prolonging fullness. Appetite and satiety: it acts on central appetite centers to reduce hunger and food intake, which drives the weight loss seen in trials. The immediate-release version (Byetta) is cleared quickly and given twice daily before meals. The extended-release version (Bydureon) uses biodegradable microspheres that release the same molecule slowly over weeks, allowing once-weekly dosing.", "legalStatus": "FDA-approved" } }, { "@context": "https://schema.org", "@type": "FAQPage", "mainEntity": [ { "@type": "Question", "name": "What is exenatide and where does it come from?", "acceptedAnswer": { "@type": "Answer", "text": "Exenatide is a synthetic copy of exendin-4, a peptide first found in the saliva of the Gila monster. It is a GLP-1 receptor agonist sold as Byetta (twice daily) and Bydureon (once weekly)." } }, { "@type": "Question", "name": "Is exenatide FDA-approved?", "acceptedAnswer": { "@type": "Answer", "text": "Yes, for type 2 diabetes. Byetta was approved in 2005 and the extended-release Bydureon in 2012. It is not FDA-approved for weight loss or for use in people without diabetes." } }, { "@type": "Question", "name": "What is the difference between Byetta and Bydureon?", "acceptedAnswer": { "@type": "Answer", "text": "Both contain the same molecule. Byetta is immediate-release and injected twice daily within 60 minutes before meals. Bydureon is an extended-release microsphere formulation injected just once a week." } }, { "@type": "Question", "name": "How much weight can you lose on exenatide?", "acceptedAnswer": { "@type": "Answer", "text": "In diabetes trials, weight loss averaged about 2 to 3 kg. In non-diabetic adults with obesity, a randomized trial found it reduced food intake but the weight difference versus placebo was not statistically significant at 24 weeks [PMID:29596853]. Its weight effect is weaker than semaglutide or tirzepatide." } }, { "@type": "Question", "name": "How does exenatide compare with semaglutide and tirzepatide?", "acceptedAnswer": { "@type": "Answer", "text": "In the head-to-head SUSTAIN 3 trial, once-weekly semaglutide beat exenatide extended-release on both blood sugar and weight [PMID:29246950]. Tirzepatide, a newer dual GIP/GLP-1 agonist, is more potent still. Exenatide is older and generally cheaper, but the newer weekly agents are stronger for weight and glucose." } }, { "@type": "Question", "name": "Does exenatide cause low blood sugar?", "acceptedAnswer": { "@type": "Answer", "text": "On its own, rarely, because it mainly stimulates insulin when glucose is high. The risk goes up when it is combined with a sulfonylurea or insulin, so those are often dose-reduced first." } } ] }, { "@context": "https://schema.org", "@type": "Organization", "@id": "https://www.bodyhackguide.co#organization", "name": "BodyHackGuide", "alternateName": "BHG", "url": "https://www.bodyhackguide.co", "logo": { "@type": "ImageObject", "url": "https://www.bodyhackguide.co/logo.png", "width": 512, "height": 512 }, "description": "Evidence-based research reference for peptides and nootropics. 273 compound profiles, interactive dosing calculators, vendor price comparisons, and trust-scored vendor reviews scored on a public, reproducible methodology applied to every vendor. We earn a commission on purchases through some of our links.", "foundingDate": "2024", "founder": { "@id": "https://www.bodyhackguide.co/about#person" }, "sameAs": [ "https://reddit.com/r/BodyHackGuide", "https://reddit.com/r/BrainHackGuide", "https://reddit.com/r/Biohackingher", "https://discord.gg/Mhq5UdRYBA" ], "knowsAbout": [ "Peptide research", "Nootropic research", "Biohacking", "Compound dosing", "Vendor transparency" ], "publishingPrinciples": "https://www.bodyhackguide.co/editorial-standards", "ethicsPolicy": "https://www.bodyhackguide.co/editorial-standards", "diversityPolicy": "https://www.bodyhackguide.co/editorial-standards" } ] ```