--- title: "LL-37 vs Thymosin Alpha-1 (TA1): Side-by-Side Comparison" description: "Compare LL-37 vs Thymosin Alpha-1 (TA1) — mechanism, half-life, dose range, side effects, and live vendor pricing. LL-37 from $45.00. Thymosin Alpha-1 (TA1)" lang: en json-ld: | [ { "@context": "https://schema.org", "@type": "BreadcrumbList", "itemListElement": [ { "@type": "ListItem", "position": 1, "name": "Home", "item": "https://www.bodyhackguide.co/" }, { "@type": "ListItem", "position": 2, "name": "Compare", "item": "https://www.bodyhackguide.co/compare" }, { "@type": "ListItem", "position": 3, "name": "LL-37 vs Thymosin Alpha-1 (TA1)" } ] }, { "@context": "https://schema.org", "@type": "WebPage", "name": "LL-37 vs Thymosin Alpha-1 (TA1): Side-by-Side Comparison (2026)", "description": "Compare LL-37 vs Thymosin Alpha-1 (TA1) — mechanism, half-life, dose range, side effects, and live vendor pricing. LL-37 from $45.00. Thymosin Alpha-1 (TA1) from $39.99. Side-by-side data from BodyHackGuide — we earn a commission on some vendor links.", "url": "https://www.bodyhackguide.co/compare/ll-37-vs-thymosin-alpha-1", "dateModified": "2026-09-08", "isPartOf": { "@type": "WebSite", "name": "BodyHackGuide", "url": "https://www.bodyhackguide.co" }, "mainEntity": { "@type": "ItemList", "itemListElement": [ { "@type": "ListItem", "position": 1, "item": { "@type": "Product", "name": "LL-37", "description": "LL-37 is the only human cathelicidin, a 37-amino-acid amphipathic alpha-helical peptide ([LL-37, 37 aa]) cleaved from the C-terminus of the 170-amino-acid precursor hCAP-18 (human cationic antimicrobial protein, 18 kDa), which is encoded by the CAMP gene on chromosome 3p21.31.…", "url": "https://www.bodyhackguide.co/compound/ll-37", "category": "Immune & Inflammation", "offers": { "@type": "AggregateOffer", "lowPrice": "45.00", "priceCurrency": "USD", "offerCount": 2 } } }, { "@type": "ListItem", "position": 2, "item": { "@type": "Product", "name": "Thymosin Alpha-1 (TA1)", "description": "Thymosin alpha-1 (Tα1) is a 28-amino-acid N-acetylated peptide (N-Ac-Ser-Asp-Ala-Ala-Val-Asp-Thr-Ser-Ser-Glu-Ile-Thr-Thr-Lys-Asp-Leu-Lys-Glu-Lys-Lys-Glu-Val-Val-Glu-Glu-Ala-Glu-Asn) isolated and characterized by Allan Goldstein's laboratory at George Washington University in the 1970s as the…", "url": "https://www.bodyhackguide.co/compound/thymosin-alpha-1", "category": "Immune & Inflammation", "offers": { "@type": "AggregateOffer", "lowPrice": "39.99", "priceCurrency": "USD", "offerCount": 4 } } } ] } }, { "@context": "https://schema.org", "@type": "Organization", "@id": "https://www.bodyhackguide.co#organization", "name": "BodyHackGuide", "alternateName": "BHG", "url": "https://www.bodyhackguide.co", "logo": { "@type": "ImageObject", "url": "https://www.bodyhackguide.co/logo.png", "width": 512, "height": 512 }, "description": "Evidence-based research reference for peptides and nootropics. 124+ compound profiles, interactive dosing calculators, real-time vendor pricing, and trust-scored vendor reviews scored on a public, reproducible methodology applied to every vendor. BodyHackGuide and BHG Labs share common ownership, and we earn a commission on purchases through our links.", "foundingDate": "2024", "founder": { "@id": "https://www.bodyhackguide.co/about#person" }, "sameAs": [ "https://x.com/bodyhackguide", "https://reddit.com/r/BodyHackGuide", "https://reddit.com/r/BrainHackGuide", "https://reddit.com/r/Biohackingher", "https://discord.gg/Mhq5UdRYBA" ], "knowsAbout": [ "Peptide research", "Nootropic research", "Biohacking", "Compound dosing", "Vendor transparency" ], "publishingPrinciples": "https://www.bodyhackguide.co/editorial-standards", "ethicsPolicy": "https://www.bodyhackguide.co/editorial-standards", "diversityPolicy": "https://www.bodyhackguide.co/editorial-standards" }, { "@context": "https://schema.org", "@type": "FAQPage", "mainEntity": [ { "@type": "Question", "name": "What's the difference between LL-37 and Thymosin Alpha-1 (TA1)?", "acceptedAnswer": { "@type": "Answer", "text": "LL-37 is a immune & inflammation that ll-37's biological activity spans three functional categories: direct antimicrobial, immunomodulatory, and tissue-remodeling. each operates through partially distinct mechanisms.…. Thymosin Alpha-1 (TA1) is a immune & inflammation that thymosin alpha-1 does not act through a single canonical receptor in the way many peptides do. its mechanism is pleiotropic, involving pattern-recognition receptors, modulation of…. The two differ in mechanism, half-life (~30 minutes (free peptide; rapidly cleared by proteolysis). Human pharmacokinetics of exogenous LL-37 are not well characterized. vs ~2 hours), and typical dose range." } }, { "@type": "Question", "name": "Which has the longer half-life, LL-37 or Thymosin Alpha-1 (TA1)?", "acceptedAnswer": { "@type": "Answer", "text": "LL-37 has a half-life of ~30 minutes (free peptide; rapidly cleared by proteolysis). Human pharmacokinetics of exogenous LL-37 are not well characterized.. Thymosin Alpha-1 (TA1) has a half-life of ~2 hours. Longer half-lives generally mean less frequent dosing but slower on/off kinetics." } }, { "@type": "Question", "name": "Which is cheaper, LL-37 or Thymosin Alpha-1 (TA1)?", "acceptedAnswer": { "@type": "Answer", "text": "Current lowest live price on BodyHackGuide: LL-37 from $45.00, Thymosin Alpha-1 (TA1) from $39.99. Prices are pulled from the vendor listings tracked on BHG and change frequently — see the compare tables on each compound page for the current set of offers." } }, { "@type": "Question", "name": "Can you stack LL-37 and Thymosin Alpha-1 (TA1)?", "acceptedAnswer": { "@type": "Answer", "text": "Stacking depends on mechanism overlap, safety profile, and goals. LL-37 and Thymosin Alpha-1 (TA1) should only be stacked after reviewing each compound's individual protocol page, side effect profile, and any published interaction data. Use the BodyHackGuide stack builder for a structured review before combining research compounds." } } ] } ] --- [Skip to content](#main-content) ## Research Use Only This site is an **educational resource** for research compounds. We do **not endorse** human consumption of any compound. BodyHackGuide and **BHG Labs share common ownership**; we rank every vendor on the same public methodology, and we earn a commission on purchases through our links. By entering, you confirm you are **21 years of age or older** and agree to our [Terms](/terms) & [Privacy Policy](/privacy). I'm 21+ — Enter SiteLeave site [![BodyHackGuide](/assets/bodyhackguide-logo-DOzZNUyh.webp)BodyHackGuide ](/) [Compare](/compare)[Wiki](/wiki)[Vendors](/vendors)[Deals](/deals)[Stacks](/stack-builder)[Nootropics](/nootropics)[Tools](/tools) Learn Community Search ⌘K [Sign In](/auth?returnTo=%2Fcompare%2Fll-37-vs-thymosin-alpha-1) 100K+ researchers trust BodyHackGuide — Join [r/BodyHackGuide](https://reddit.com/r/bodyhackguide) 1. [Home](/) 2. [Compare](/compare) 3. LL-37 vs Thymosin Alpha-1 (TA1) # LL-37 vs Thymosin Alpha-1 (TA1) Side-by-side comparison of LL-37 and Thymosin Alpha-1 (TA1): mechanism, half-life, dose range, safety profile, and live vendor pricing. Updated continuously as new research and listings land. LL-37 from $45.00 Thymosin Alpha-1 (TA1) from $39.99 ## Live price snapshot ### LL-37 Current low $49.99 as of Sep 5, 2026 7-day low $49.99 30-day low $49.99 30-day change — baseline building ### Thymosin Alpha-1 (TA1) Current low $49.99 as of Sep 5, 2026 7-day low $49.99 30-day low $49.99 30-day change — baseline building ## LL-37 LL-37 is the only human cathelicidin, a 37-amino-acid amphipathic alpha-helical peptide ([LL-37, 37 aa]) cleaved from the C-terminus of the 170-amino-acid precursor hCAP-18 (human cationic… **Live lowest price:** $45.00 across 2 vendors [Full LL-37 profile](/compound/ll-37) ## Thymosin Alpha-1 (TA1) Thymosin alpha-1 (Tα1) is a 28-amino-acid N-acetylated peptide (N-Ac-Ser-Asp-Ala-Ala-Val-Asp-Thr-Ser-Ser-Glu-Ile-Thr-Thr-Lys-Asp-Leu-Lys-Glu-Lys-Lys-Glu-Val-Val-Glu-Glu-Ala-Glu-Asn) isolated and characterized by Allan… **Live lowest price:** $39.99 across 4 vendors [Full Thymosin Alpha-1 (TA1) profile](/compound/thymosin-alpha-1) ## Side-by-side comparison Attribute LL-37 Thymosin Alpha-1 (TA1) Category Immune & Inflammation Immune & Inflammation Research Stage Clinical Approved (International) Mechanism of Action LL-37's biological activity spans three functional categories: direct antimicrobial, immunomodulatory, and tissue-remodeling. Each operates through partially distinct mechanisms. Direct Antimicrobial Mechanism (Membrane Disruption): LL-37 is a cationic… Thymosin alpha-1 does not act through a single canonical receptor in the way many peptides do. Its mechanism is pleiotropic, involving pattern-recognition receptors, modulation of immune cell maturation and function, and shifts in cytokine signaling patterns.… Half-Life ~30 minutes (free peptide; rapidly cleared by proteolysis). Human pharmacokinetics of exogenous LL-37 are not well characterized. ~2 hours Typical Dose Range — 1,600 mcg (1.6 mg) per injection (standard clinical dose) Dosing Frequency — Twice weekly (subcutaneous) - the approved Zadaxin schedule; alternatively 900 mcg daily for intensive short-term courses Administration — Subcutaneous Side Effects LL-37 has a less benign side-effect profile than many peptides covered in this guide, reflecting its mechanistic potency and narrow therapeutic window. Common (injection site): - Injection site irritation — more pronounced than with most peptides. Redness,… Tα1 has one of the most benign side-effect profiles in the peptide space, supported by 45+ years of clinical experience in approved indications. Most users experience no acute side effects beyond mild injection site discomfort. Common (5-15% of users): -… Molecular Weight 4493.4 g/mol 3108 Da Common Vial Sizes — 5mg, 10mg ## Price History 3 data points - VANDL Labs - Ion Peptide - Disguised Alpha ## Price History 4 data points - OF - VANDL Labs - Ion Peptide - Disguised Alpha ### LL-37 — potential benefits - Broad-spectrum antimicrobial activity - Wound healing acceleration - Biofilm disruption - Immune system modulation - Anti-inflammatory effects - Gut barrier support ### Thymosin Alpha-1 (TA1) — potential benefits - Immune enhancement - Antiviral defense - Cancer adjuvant therapy - Autoimmune modulation - Vaccine potentiation ## Frequently asked ### What's the difference between LL-37 and Thymosin Alpha-1 (TA1)? LL-37 is a immune & inflammation that ll-37's biological activity spans three functional categories: direct antimicrobial, immunomodulatory, and tissue-remodeling. each operates through partially distinct mechanisms.…. Thymosin Alpha-1 (TA1) is a immune & inflammation that thymosin alpha-1 does not act through a single canonical receptor in the way many peptides do. its mechanism is pleiotropic, involving pattern-recognition receptors, modulation of…. The two differ in mechanism, half-life (~30 minutes (free peptide; rapidly cleared by proteolysis). Human pharmacokinetics of exogenous LL-37 are not well characterized. vs ~2 hours), and typical dose range. ### Which has the longer half-life, LL-37 or Thymosin Alpha-1 (TA1)? LL-37 has a half-life of ~30 minutes (free peptide; rapidly cleared by proteolysis). Human pharmacokinetics of exogenous LL-37 are not well characterized.. Thymosin Alpha-1 (TA1) has a half-life of ~2 hours. Longer half-lives generally mean less frequent dosing but slower on/off kinetics. ### Which is cheaper, LL-37 or Thymosin Alpha-1 (TA1)? Current lowest live price on BodyHackGuide: LL-37 from $45.00, Thymosin Alpha-1 (TA1) from $39.99. Prices are pulled from the vendor listings tracked on BHG and change frequently — see the compare tables on each compound page for the current set of offers. ### Can you stack LL-37 and Thymosin Alpha-1 (TA1)? Stacking depends on mechanism overlap, safety profile, and goals. LL-37 and Thymosin Alpha-1 (TA1) should only be stacked after reviewing each compound's individual protocol page, side effect profile, and any published interaction data. Use the BodyHackGuide stack builder for a structured review before combining research compounds. ## See current vendor prices Live listings from the vendors we track, refreshed continuously. [LL-37 prices](/compound/ll-37?tab=prices) [Thymosin Alpha-1 (TA1) prices](/compound/thymosin-alpha-1?tab=prices) [Compare all compounds](/compare) ### Before you buy LL-37 or Thymosin Alpha-1 (TA1) Check the vendor trust score. Every supplier we track is rated 0–100 on COA verification, payment transparency, shipping, reviews, and listings — one published, reproducible methodology, applied to every vendor including BHG Labs, which shares our ownership. [View Vendor Scorecard](/vendors/scorecard) ## Related comparisons [Thymosin-Alpha-1 vs BPC-157](/compare/thymosin-alpha-1-vs-bpc-157)[LL-37 vs BPC-157](/compare/ll-37-vs-bpc-157)[TB-500 vs Thymosin-Alpha-1](/compare/tb-500-vs-thymosin-alpha-1)[BPC-157 vs TB-500](/compare/bpc-157-vs-tb-500)[KPV vs BPC-157](/compare/kpv-vs-bpc-157) **Research use only.** BodyHackGuide is a research and price-comparison reference. BodyHackGuide and BHG Labs share common ownership. The compounds discussed on this page are not approved by the FDA for human consumption and are sold strictly for laboratory research. Prices shown are pulled from vendor listings tracked on BHG and are subject to change. We earn an affiliate commission on some outbound clicks, and every vendor is ranked on the same public, reproducible methodology. See [editorial standards](/editorial-standards) and [affiliate disclosure](/affiliate-disclosure). ![BodyHackGuide](/assets/bodyhackguide-logo-DOzZNUyh.webp) ### BodyHackGuide Your biohacking research hub — compound pricing, brain health protocols, dosing tools, and vendor reviews. [support@bodyhackguide.co](mailto:support@bodyhackguide.co) [](https://discord.gg/Mhq5UdRYBA)[](https://reddit.com/r/BodyHackGuide)[](https://x.com/bodyhackguide) Explore #### Explore - [Compare prices](/compare) - [Research suppliers](/vendors) - [Deals](/deals) - [Coupons](/coupons) - [Nootropics](/nootropics) - [Brain health](/brain-health) - [Blog](/blog) - [Guides](/guides) Tools #### Tools - [Reconstitution](/tools/reconstitution) - [Dosage calculator](/tools/dosage) - [Half-life visualizer](/tools/halflife) - [COA lookup](/tools/coa) - [Cost calculator](/tools/cost-calculator) - [Stack builder](/stack-builder) - [All tools →](/tools) Trust & vendors #### Trust & vendors - [Vendor directory](/vendors) - [Trust scorecard](/vendors/scorecard) - [Get BHG verified](/vendors/get-vetted) - [Scoring methodology](/vendors/methodology) - [Peptide cheatsheet](/guides/peptide-cheat-sheet-download) Company #### Company - [About](/about) - [Affiliate disclosure](/affiliate-disclosure) - [Editorial standards](/editorial-standards) - [Creators](/creators) - [Coaches](/coaches) - [Privacy](/privacy) - [Terms](/terms) - [Full site directory →](/site-directory) **Ownership & Affiliate Disclosure:** BodyHackGuide and BHG Labs share common ownership. We rank every vendor on the same public, reproducible [methodology](/vendors/methodology), and we earn a commission from purchases made through our links at no extra cost to you. Full details in our [affiliate disclosure](/affiliate-disclosure). **Research Disclaimer:** All compounds listed are for laboratory and research purposes only. Not for human consumption. This site does not sell, distribute, or promote any products. Always consult a qualified healthcare professional and comply with local regulations. © 2026 BodyHackGuide. All rights reserved. · [Terms](/terms) · [Privacy](/privacy) [Shop BHG Labs · 20% off with BHG20](https://bhglabs.co/shop/?utm_source=reddit&utm_medium=paid&utm_campaign=bhg20_bridge&utm_content=sticky_mobile_bar&ref=zmgqyxku&coupon=BHG20) hi 👋