--- title: "LL-37 vs Pinealon: Side-by-Side Comparison (2026)" url: https://www.bodyhackguide.co/compare/ll-37-vs-pinealon description: "Compare LL-37 vs Pinealon side by side. We earn a commission on some vendor links. Mechanism, half-life, dose range, side effects and prices. LL-37 from $45.00." lang: en --- Skip to content Compare notes on r/BodyHackGuide (https://reddit.com/r/bodyhackguide) Compare notes with other researchers. Join r/BodyHackGuide (https://reddit.com/r/bodyhackguide) # LL-37 vs Pinealon Side-by-side comparison of LL-37 and Pinealon: mechanism, half-life, dose range, safety profile, and vendor pricing. LL-37 from $45.00 Pinealon from $45.00 ## Price snapshot ### LL-37 Current low $45.00 current listings 7-day low — not enough history yet 30-day low — not enough history yet 30-day change — not enough history yet ### Pinealon Current low $45.00 current listings 7-day low — not enough history yet 30-day low — not enough history yet 30-day change — not enough history yet ## LL-37 LL-37 is the only human cathelicidin, a 37-amino-acid amphipathic alpha-helical peptide ([LL-37, 37 aa]) cleaved from the C-terminus of the 170-amino-acid precursor hCAP-18 (human cationic… **Lowest listed price:** $45.00 across 2 listings Full LL-37 profile (https://www.bodyhackguide.co/compound/ll-37) ## Pinealon Pinealon is a synthetic tripeptide — glutamyl-aspartyl-arginine (Glu-Asp-Arg, or EDR) — developed by the St Petersburg Institute of Bioregulation and Gerontology (IBG) under the leadership of Professor Vladimir… **Lowest listed price:** $45.00 across 3 listings Full Pinealon profile (https://www.bodyhackguide.co/compound/pinealon) ## Side-by-side comparison | Attribute | LL-37 | Pinealon | | --- | --- | --- | | Category | Immune & Inflammation | Nootropics | | Research Stage | Clinical | Preclinical | | Mechanism of Action | LL-37's biological activity spans three functional categories: direct antimicrobial, immunomodulatory, and tissue-remodeling. Each operates through partially distinct mechanisms. Direct Antimicrobial Mechanism (Membrane Disruption): LL-37 is a cationic… | The proposed mechanism of Pinealon is rooted in the Khavinson school's broader theory of short-peptide tissue-specific bioregulation. The full theory is worth understanding because it underlies all twelve Russian bioregulator compounds in this catalog. The… | | Half-Life | ~30 minutes (free peptide; rapidly cleared by proteolysis). Human pharmacokinetics of exogenous LL-37 are not well characterized. | Not formally characterized in humans. Short regulatory peptides of this class are cleared from plasma within minutes; the Khavinson framework proposes durable downstream gene-expression effects that outlast the brief dosing window, which is the stated rationale for pulsed cycling rather than continuous dosing. | | Typical Dose Range | — | Subcutaneous (primary route): 2-10 mg/day, typically 3-5 mg, in pulsed 10-20 day cycles, 2-4 cycles/year. Intranasal: 150-800 mcg per nostril daily. Research use only; oral dosing is not recommended because the peptide is largely degraded by GI proteases. | | Dosing Frequency | — | Once daily during a cycle (morning preferred); some advanced users split into AM + midday doses. Not dosed continuously year-round - cycles are pulsed. | | Administration | — | — | | Side Effects | LL-37 has a less benign side-effect profile than many peptides covered in this guide, reflecting its mechanistic potency and narrow therapeutic window. Common (injection site): - Injection site irritation — more pronounced than with most peptides. Redness,… | The side-effect profile of Pinealon, based on the available Russian clinical literature and user-reported experience, is described as mild and uncommon. Whether this reflects genuinely low toxicity or inadequate reporting in the available studies is a… | | Molecular Weight | 4493.4 g/mol | 418.40 g/mol (C15H26N6O8) | | Common Vial Sizes | — | — | ## Price History 2 data points - Ion Peptide - Disguised Alpha ## Price History 2 data points - Ion Peptide - Disguised Alpha ### LL-37: potential benefits - Broad-spectrum antimicrobial activity - Wound healing acceleration - Biofilm disruption - Immune system modulation - Anti-inflammatory effects - Gut barrier support ### Pinealon: potential benefits - Neuroprotection against oxidative and hypoxic stress (preclinical models) - Antioxidant support - reduced oxidative DNA damage in aged neurons (in vitro) - Cognitive and memory support in aging populations (small Russian clinical reports) - Reduced neuronal apoptosis and support of dendritic-tree integrity in cell models - Investigated for neuroprotection in Alzheimer's-model systems (preclinical) ## Frequently asked ### What's the difference between LL-37 and Pinealon? LL-37 is a immune & inflammation that ll-37's biological activity spans three functional categories: direct antimicrobial, immunomodulatory, and tissue-remodeling. each operates through partially distinct mechanisms.…. Pinealon is a nootropics that the proposed mechanism of pinealon is rooted in the khavinson school's broader theory of short-peptide tissue-specific bioregulation. the full theory is worth understanding because…. The two differ in mechanism, half-life (~30 minutes (free peptide; rapidly cleared by proteolysis). Human pharmacokinetics of exogenous LL-37 are not well characterized. vs Not formally characterized in humans. Short regulatory peptides of this class are cleared from plasma within minutes; the Khavinson framework proposes durable downstream gene-expression effects that outlast the brief dosing window, which is the stated rationale for pulsed cycling rather than continuous dosing.), and typical dose range. ### Which has the longer half-life, LL-37 or Pinealon? LL-37 has a half-life of ~30 minutes (free peptide; rapidly cleared by proteolysis). Human pharmacokinetics of exogenous LL-37 are not well characterized.. Pinealon has a half-life of Not formally characterized in humans. Short regulatory peptides of this class are cleared from plasma within minutes; the Khavinson framework proposes durable downstream gene-expression effects that outlast the brief dosing window, which is the stated rationale for pulsed cycling rather than continuous dosing.. Longer half-lives generally mean less frequent dosing but slower on/off kinetics. ### Which is cheaper, LL-37 or Pinealon? Lowest listed price on BodyHackGuide: LL-37 from $45.00, Pinealon from $45.00. Prices are pulled from the vendor listings tracked on BHG and change frequently. See the compare tables on each compound page for the current set of offers. ### Can you stack LL-37 and Pinealon? Stacking depends on mechanism overlap, safety profile, and goals. LL-37 and Pinealon should only be stacked after reviewing each compound's individual protocol page, side effect profile, and any published interaction data. Use the BodyHackGuide stack builder for a structured review before combining research compounds. ## See current vendor prices Listings from the vendors we track. Prices change often, so check the vendor before you buy. LL-37 prices: https://www.bodyhackguide.co/compound/ll-37?tab=prices Pinealon prices: https://www.bodyhackguide.co/compound/pinealon?tab=prices Compare all compounds: https://www.bodyhackguide.co/compare ### Before you buy LL-37 or Pinealon Check the vendor trust score. Every supplier we track is rated 0-100 on COA verification, payment transparency, shipping, reviews, and listings: one published, reproducible methodology, applied to every vendor. View Vendor Scorecard (https://www.bodyhackguide.co/vendors/scorecard) ## Related comparisons LL-37 vs BPC-157: https://www.bodyhackguide.co/compare/ll-37-vs-bpc-157 LL-37 vs Thymosin-Alpha-1: https://www.bodyhackguide.co/compare/ll-37-vs-thymosin-alpha-1 Pinealon vs Epithalon: https://www.bodyhackguide.co/compare/pinealon-vs-epithalon **Research use only.** BodyHackGuide is a research and price-comparison reference. The compounds discussed on this page are not approved by the FDA for human consumption and are sold strictly for laboratory research. Prices shown are pulled from vendor listings tracked on BHG and are subject to change. Every vendor is ranked on the same public, reproducible methodology. See editorial standards (https://www.bodyhackguide.co/editorial-standards) and affiliate disclosure (https://www.bodyhackguide.co/affiliate-disclosure). BodyHackGuide (https://www.bodyhackguide.co/) Your biohacking research hub: compound pricing, brain health protocols, dosing tools, and vendor reviews. support@bodyhackguide.co Join our Discord: https://discord.gg/Mhq5UdRYBA r/BodyHackGuide on Reddit: https://reddit.com/r/BodyHackGuide **Affiliate Disclosure:** We rank every vendor on the same public, reproducible methodology (https://www.bodyhackguide.co/vendors/methodology). Full details in our affiliate disclosure (https://www.bodyhackguide.co/affiliate-disclosure). **Research Disclaimer:** All compounds listed are for laboratory and research purposes only. Not for human consumption. This site does not sell or ship any products. Always consult a qualified healthcare professional and comply with local regulations. © 2026 BodyHackGuide. All rights reserved. - Terms: https://www.bodyhackguide.co/terms - Privacy: https://www.bodyhackguide.co/privacy ## Structured data ```json [ { "@context": "https://schema.org", "@type": "BreadcrumbList", "itemListElement": [ { "@type": "ListItem", "position": 1, "name": "Home", "item": "https://www.bodyhackguide.co/" }, { "@type": "ListItem", "position": 2, "name": "Compare", "item": "https://www.bodyhackguide.co/compare" }, { "@type": "ListItem", "position": 3, "name": "LL-37 vs Pinealon" } ] }, { "@context": "https://schema.org", "@type": "WebPage", "name": "LL-37 vs Pinealon: Side-by-Side Comparison (2026)", "description": "Compare LL-37 vs Pinealon side by side. We earn a commission on some vendor links. Mechanism, half-life, dose range, side effects and prices. LL-37 from $45.00.", "url": "https://www.bodyhackguide.co/compare/ll-37-vs-pinealon", "dateModified": "2026-10-26", "isPartOf": { "@type": "WebSite", "name": "BodyHackGuide", "url": "https://www.bodyhackguide.co" }, "mainEntity": { "@type": "ItemList", "itemListElement": [ { "@type": "ListItem", "position": 1, "item": { "@type": "Product", "name": "LL-37", "description": "LL-37 is the only human cathelicidin, a 37-amino-acid amphipathic alpha-helical peptide ([LL-37, 37 aa]) cleaved from the C-terminus of the 170-amino-acid precursor hCAP-18 (human cationic antimicrobial protein, 18 kDa), which is encoded by the CAMP gene on chromosome 3p21.31.…", "url": "https://www.bodyhackguide.co/compound/ll-37", "category": "Immune & Inflammation", "offers": { "@type": "AggregateOffer", "lowPrice": "45.00", "priceCurrency": "USD", "offerCount": 2 } } }, { "@type": "ListItem", "position": 2, "item": { "@type": "Product", "name": "Pinealon", "description": "Pinealon is a synthetic tripeptide — glutamyl-aspartyl-arginine (Glu-Asp-Arg, or EDR) — developed by the St Petersburg Institute of Bioregulation and Gerontology (IBG) under the leadership of Professor Vladimir Khavinson, the dominant figure in what is collectively known as the \"Russian…", "url": "https://www.bodyhackguide.co/compound/pinealon", "category": "Nootropics", "offers": { "@type": "AggregateOffer", "lowPrice": "45.00", "priceCurrency": "USD", "offerCount": 3 } } } ] } }, { "@context": "https://schema.org", "@type": "Organization", "@id": "https://www.bodyhackguide.co#organization", "name": "BodyHackGuide", "alternateName": "BHG", "url": "https://www.bodyhackguide.co", "logo": { "@type": "ImageObject", "url": "https://www.bodyhackguide.co/logo.png", "width": 512, "height": 512 }, "description": "Evidence-based research reference for peptides and nootropics. 273 compound profiles, interactive dosing calculators, vendor price comparisons, and trust-scored vendor reviews scored on a public, reproducible methodology applied to every vendor. We earn a commission on purchases through some of our links.", "foundingDate": "2024", "founder": { "@id": "https://www.bodyhackguide.co/about#person" }, "sameAs": [ "https://reddit.com/r/BodyHackGuide", "https://reddit.com/r/BrainHackGuide", "https://reddit.com/r/Biohackingher", "https://discord.gg/Mhq5UdRYBA" ], "knowsAbout": [ "Peptide research", "Nootropic research", "Biohacking", "Compound dosing", "Vendor transparency" ], "publishingPrinciples": "https://www.bodyhackguide.co/editorial-standards", "ethicsPolicy": "https://www.bodyhackguide.co/editorial-standards", "diversityPolicy": "https://www.bodyhackguide.co/editorial-standards" }, { "@context": "https://schema.org", "@type": "FAQPage", "mainEntity": [ { "@type": "Question", "name": "What's the difference between LL-37 and Pinealon?", "acceptedAnswer": { "@type": "Answer", "text": "LL-37 is a immune & inflammation that ll-37's biological activity spans three functional categories: direct antimicrobial, immunomodulatory, and tissue-remodeling. each operates through partially distinct mechanisms.…. Pinealon is a nootropics that the proposed mechanism of pinealon is rooted in the khavinson school's broader theory of short-peptide tissue-specific bioregulation. the full theory is worth understanding because…. The two differ in mechanism, half-life (~30 minutes (free peptide; rapidly cleared by proteolysis). Human pharmacokinetics of exogenous LL-37 are not well characterized. vs Not formally characterized in humans. Short regulatory peptides of this class are cleared from plasma within minutes; the Khavinson framework proposes durable downstream gene-expression effects that outlast the brief dosing window, which is the stated rationale for pulsed cycling rather than continuous dosing.), and typical dose range." } }, { "@type": "Question", "name": "Which has the longer half-life, LL-37 or Pinealon?", "acceptedAnswer": { "@type": "Answer", "text": "LL-37 has a half-life of ~30 minutes (free peptide; rapidly cleared by proteolysis). Human pharmacokinetics of exogenous LL-37 are not well characterized.. Pinealon has a half-life of Not formally characterized in humans. Short regulatory peptides of this class are cleared from plasma within minutes; the Khavinson framework proposes durable downstream gene-expression effects that outlast the brief dosing window, which is the stated rationale for pulsed cycling rather than continuous dosing.. Longer half-lives generally mean less frequent dosing but slower on/off kinetics." } }, { "@type": "Question", "name": "Which is cheaper, LL-37 or Pinealon?", "acceptedAnswer": { "@type": "Answer", "text": "Lowest listed price on BodyHackGuide: LL-37 from $45.00, Pinealon from $45.00. Prices are pulled from the vendor listings tracked on BHG and change frequently. See the compare tables on each compound page for the current set of offers." } }, { "@type": "Question", "name": "Can you stack LL-37 and Pinealon?", "acceptedAnswer": { "@type": "Answer", "text": "Stacking depends on mechanism overlap, safety profile, and goals. LL-37 and Pinealon should only be stacked after reviewing each compound's individual protocol page, side effect profile, and any published interaction data. Use the BodyHackGuide stack builder for a structured review before combining research compounds." } } ] } ] ```