--- title: "LL-37 vs Cartalax: Side-by-Side Comparison (2026)" url: https://www.bodyhackguide.co/compare/ll-37-vs-cartalax description: "Compare LL-37 vs Cartalax side by side. We earn a commission on some vendor links. Mechanism, half-life, dose range, side effects and prices. LL-37 from $45.00." lang: en --- Skip to content Compare notes on r/BodyHackGuide (https://reddit.com/r/bodyhackguide) Compare notes with other researchers. Join r/BodyHackGuide (https://reddit.com/r/bodyhackguide) # LL-37 vs Cartalax Side-by-side comparison of LL-37 and Cartalax: mechanism, half-life, dose range, safety profile, and vendor pricing. LL-37 from $45.00 Cartalax from $49.99 ## Price snapshot ### LL-37 Current low $45.00 current listings 7-day low — not enough history yet 30-day low — not enough history yet 30-day change — not enough history yet ### Cartalax Current low $49.99 current listings 7-day low — not enough history yet 30-day low — not enough history yet 30-day change — not enough history yet ## LL-37 LL-37 is the only human cathelicidin, a 37-amino-acid amphipathic alpha-helical peptide ([LL-37, 37 aa]) cleaved from the C-terminus of the 170-amino-acid precursor hCAP-18 (human cationic… **Lowest listed price:** $45.00 across 2 listings Full LL-37 profile (https://www.bodyhackguide.co/compound/ll-37) ## Cartalax Cartalax is a short synthetic peptide developed in Russia by Vladimir Khavinson and colleagues at the St. Petersburg Institute of Bioregulation and Gerontology, positioned as a "cartilage bioregulator" intended to… **Lowest listed price:** $49.99 across 3 listings Full Cartalax profile (https://www.bodyhackguide.co/compound/cartalax) ## Side-by-side comparison | Attribute | LL-37 | Cartalax | | --- | --- | --- | | Category | Immune & Inflammation | Recovery | | Research Stage | Clinical | Preclinical | | Mechanism of Action | LL-37's biological activity spans three functional categories: direct antimicrobial, immunomodulatory, and tissue-remodeling. Each operates through partially distinct mechanisms. Direct Antimicrobial Mechanism (Membrane Disruption): LL-37 is a cationic… | Mechanism of Action Cartalax's proposed mechanism is the Khavinson short-peptide framework applied to cartilage: passive membrane permeation, nuclear import, and sequence-selective chromatin modulation producing chondrocyte-favourable transcriptional shifts.… | | Half-Life | ~30 minutes (free peptide; rapidly cleared by proteolysis). Human pharmacokinetics of exogenous LL-37 are not well characterized. | No published human or animal pharmacokinetic data for Cartalax. As a small (~446.5 Da) tetrapeptide, rapid plasma hydrolysis (on the order of minutes) is expected, consistent with other Khavinson short peptides, but this has not been directly measured. | | Typical Dose Range | — | 20 mg oral/sublingual once daily for 10 days; 60-90 day washout | | Dosing Frequency | — | Once daily | | Administration | — | — | | Side Effects | LL-37 has a less benign side-effect profile than many peptides covered in this guide, reflecting its mechanistic potency and narrow therapeutic window. Common (injection site): - Injection site irritation — more pronounced than with most peptides. Redness,… | Side Effects and Safety Cartalax has been used in Russian clinical settings for roughly 20 years with a sparse adverse-event literature — reassuring in direction, insufficient for confident pharmacovigilance. Reported short-term adverse effects -… | | Molecular Weight | 4493.4 g/mol | 446.5 Da (C18H30N4O9) | | Common Vial Sizes | — | — | ## Price History 2 data points - Ion Peptide - Disguised Alpha ## Price History 3 data points - Ion Peptide - Disguised Alpha - LB ### LL-37: potential benefits - Broad-spectrum antimicrobial activity - Wound healing acceleration - Biofilm disruption - Immune system modulation - Anti-inflammatory effects - Gut barrier support ### Cartalax: potential benefits - Joint and cartilage repair support - Connective tissue maintenance - Anti-aging effects on musculoskeletal system - Improved joint mobility ## Frequently asked ### What's the difference between LL-37 and Cartalax? LL-37 is a immune & inflammation that ll-37's biological activity spans three functional categories: direct antimicrobial, immunomodulatory, and tissue-remodeling. each operates through partially distinct mechanisms.…. Cartalax is a recovery that mechanism of action cartalax's proposed mechanism is the khavinson short-peptide framework applied to cartilage: passive membrane permeation, nuclear import, and sequence-selective…. The two differ in mechanism, half-life (~30 minutes (free peptide; rapidly cleared by proteolysis). Human pharmacokinetics of exogenous LL-37 are not well characterized. vs No published human or animal pharmacokinetic data for Cartalax. As a small (~446.5 Da) tetrapeptide, rapid plasma hydrolysis (on the order of minutes) is expected, consistent with other Khavinson short peptides, but this has not been directly measured.), and typical dose range. ### Which has the longer half-life, LL-37 or Cartalax? LL-37 has a half-life of ~30 minutes (free peptide; rapidly cleared by proteolysis). Human pharmacokinetics of exogenous LL-37 are not well characterized.. Cartalax has a half-life of No published human or animal pharmacokinetic data for Cartalax. As a small (~446.5 Da) tetrapeptide, rapid plasma hydrolysis (on the order of minutes) is expected, consistent with other Khavinson short peptides, but this has not been directly measured.. Longer half-lives generally mean less frequent dosing but slower on/off kinetics. ### Which is cheaper, LL-37 or Cartalax? Lowest listed price on BodyHackGuide: LL-37 from $45.00, Cartalax from $49.99. Prices are pulled from the vendor listings tracked on BHG and change frequently. See the compare tables on each compound page for the current set of offers. ### Can you stack LL-37 and Cartalax? Stacking depends on mechanism overlap, safety profile, and goals. LL-37 and Cartalax should only be stacked after reviewing each compound's individual protocol page, side effect profile, and any published interaction data. Use the BodyHackGuide stack builder for a structured review before combining research compounds. ## See current vendor prices Listings from the vendors we track. Prices change often, so check the vendor before you buy. LL-37 prices: https://www.bodyhackguide.co/compound/ll-37?tab=prices Cartalax prices: https://www.bodyhackguide.co/compound/cartalax?tab=prices Compare all compounds: https://www.bodyhackguide.co/compare ### Before you buy LL-37 or Cartalax Check the vendor trust score. Every supplier we track is rated 0-100 on COA verification, payment transparency, shipping, reviews, and listings: one published, reproducible methodology, applied to every vendor. View Vendor Scorecard (https://www.bodyhackguide.co/vendors/scorecard) ## Related comparisons LL-37 vs BPC-157: https://www.bodyhackguide.co/compare/ll-37-vs-bpc-157 LL-37 vs Thymosin-Alpha-1: https://www.bodyhackguide.co/compare/ll-37-vs-thymosin-alpha-1 **Research use only.** BodyHackGuide is a research and price-comparison reference. The compounds discussed on this page are not approved by the FDA for human consumption and are sold strictly for laboratory research. Prices shown are pulled from vendor listings tracked on BHG and are subject to change. Every vendor is ranked on the same public, reproducible methodology. See editorial standards (https://www.bodyhackguide.co/editorial-standards) and affiliate disclosure (https://www.bodyhackguide.co/affiliate-disclosure). BodyHackGuide (https://www.bodyhackguide.co/) Your biohacking research hub: compound pricing, brain health protocols, dosing tools, and vendor reviews. support@bodyhackguide.co Join our Discord: https://discord.gg/Mhq5UdRYBA r/BodyHackGuide on Reddit: https://reddit.com/r/BodyHackGuide **Affiliate Disclosure:** We rank every vendor on the same public, reproducible methodology (https://www.bodyhackguide.co/vendors/methodology). Full details in our affiliate disclosure (https://www.bodyhackguide.co/affiliate-disclosure). **Research Disclaimer:** All compounds listed are for laboratory and research purposes only. Not for human consumption. This site does not sell or ship any products. Always consult a qualified healthcare professional and comply with local regulations. © 2026 BodyHackGuide. All rights reserved. - Terms: https://www.bodyhackguide.co/terms - Privacy: https://www.bodyhackguide.co/privacy ## Structured data ```json [ { "@context": "https://schema.org", "@type": "BreadcrumbList", "itemListElement": [ { "@type": "ListItem", "position": 1, "name": "Home", "item": "https://www.bodyhackguide.co/" }, { "@type": "ListItem", "position": 2, "name": "Compare", "item": "https://www.bodyhackguide.co/compare" }, { "@type": "ListItem", "position": 3, "name": "LL-37 vs Cartalax" } ] }, { "@context": "https://schema.org", "@type": "WebPage", "name": "LL-37 vs Cartalax: Side-by-Side Comparison (2026)", "description": "Compare LL-37 vs Cartalax side by side. We earn a commission on some vendor links. Mechanism, half-life, dose range, side effects and prices. LL-37 from $45.00.", "url": "https://www.bodyhackguide.co/compare/ll-37-vs-cartalax", "dateModified": "2026-10-26", "isPartOf": { "@type": "WebSite", "name": "BodyHackGuide", "url": "https://www.bodyhackguide.co" }, "mainEntity": { "@type": "ItemList", "itemListElement": [ { "@type": "ListItem", "position": 1, "item": { "@type": "Product", "name": "LL-37", "description": "LL-37 is the only human cathelicidin, a 37-amino-acid amphipathic alpha-helical peptide ([LL-37, 37 aa]) cleaved from the C-terminus of the 170-amino-acid precursor hCAP-18 (human cationic antimicrobial protein, 18 kDa), which is encoded by the CAMP gene on chromosome 3p21.31.…", "url": "https://www.bodyhackguide.co/compound/ll-37", "category": "Immune & Inflammation", "offers": { "@type": "AggregateOffer", "lowPrice": "45.00", "priceCurrency": "USD", "offerCount": 2 } } }, { "@type": "ListItem", "position": 2, "item": { "@type": "Product", "name": "Cartalax", "description": "Cartalax is a short synthetic peptide developed in Russia by Vladimir Khavinson and colleagues at the St. Petersburg Institute of Bioregulation and Gerontology, positioned as a \"cartilage bioregulator\" intended to support chondrocyte function, cartilage matrix synthesis, and joint tissue resilience…", "url": "https://www.bodyhackguide.co/compound/cartalax", "category": "Recovery", "offers": { "@type": "AggregateOffer", "lowPrice": "49.99", "priceCurrency": "USD", "offerCount": 3 } } } ] } }, { "@context": "https://schema.org", "@type": "Organization", "@id": "https://www.bodyhackguide.co#organization", "name": "BodyHackGuide", "alternateName": "BHG", "url": "https://www.bodyhackguide.co", "logo": { "@type": "ImageObject", "url": "https://www.bodyhackguide.co/logo.png", "width": 512, "height": 512 }, "description": "Evidence-based research reference for peptides and nootropics. 273 compound profiles, interactive dosing calculators, vendor price comparisons, and trust-scored vendor reviews scored on a public, reproducible methodology applied to every vendor. We earn a commission on purchases through some of our links.", "foundingDate": "2024", "founder": { "@id": "https://www.bodyhackguide.co/about#person" }, "sameAs": [ "https://reddit.com/r/BodyHackGuide", "https://reddit.com/r/BrainHackGuide", "https://reddit.com/r/Biohackingher", "https://discord.gg/Mhq5UdRYBA" ], "knowsAbout": [ "Peptide research", "Nootropic research", "Biohacking", "Compound dosing", "Vendor transparency" ], "publishingPrinciples": "https://www.bodyhackguide.co/editorial-standards", "ethicsPolicy": "https://www.bodyhackguide.co/editorial-standards", "diversityPolicy": "https://www.bodyhackguide.co/editorial-standards" }, { "@context": "https://schema.org", "@type": "FAQPage", "mainEntity": [ { "@type": "Question", "name": "What's the difference between LL-37 and Cartalax?", "acceptedAnswer": { "@type": "Answer", "text": "LL-37 is a immune & inflammation that ll-37's biological activity spans three functional categories: direct antimicrobial, immunomodulatory, and tissue-remodeling. each operates through partially distinct mechanisms.…. Cartalax is a recovery that mechanism of action cartalax's proposed mechanism is the khavinson short-peptide framework applied to cartilage: passive membrane permeation, nuclear import, and sequence-selective…. The two differ in mechanism, half-life (~30 minutes (free peptide; rapidly cleared by proteolysis). Human pharmacokinetics of exogenous LL-37 are not well characterized. vs No published human or animal pharmacokinetic data for Cartalax. As a small (~446.5 Da) tetrapeptide, rapid plasma hydrolysis (on the order of minutes) is expected, consistent with other Khavinson short peptides, but this has not been directly measured.), and typical dose range." } }, { "@type": "Question", "name": "Which has the longer half-life, LL-37 or Cartalax?", "acceptedAnswer": { "@type": "Answer", "text": "LL-37 has a half-life of ~30 minutes (free peptide; rapidly cleared by proteolysis). Human pharmacokinetics of exogenous LL-37 are not well characterized.. Cartalax has a half-life of No published human or animal pharmacokinetic data for Cartalax. As a small (~446.5 Da) tetrapeptide, rapid plasma hydrolysis (on the order of minutes) is expected, consistent with other Khavinson short peptides, but this has not been directly measured.. Longer half-lives generally mean less frequent dosing but slower on/off kinetics." } }, { "@type": "Question", "name": "Which is cheaper, LL-37 or Cartalax?", "acceptedAnswer": { "@type": "Answer", "text": "Lowest listed price on BodyHackGuide: LL-37 from $45.00, Cartalax from $49.99. Prices are pulled from the vendor listings tracked on BHG and change frequently. See the compare tables on each compound page for the current set of offers." } }, { "@type": "Question", "name": "Can you stack LL-37 and Cartalax?", "acceptedAnswer": { "@type": "Answer", "text": "Stacking depends on mechanism overlap, safety profile, and goals. LL-37 and Cartalax should only be stacked after reviewing each compound's individual protocol page, side effect profile, and any published interaction data. Use the BodyHackGuide stack builder for a structured review before combining research compounds." } } ] } ] ```