--- title: "LL-37 vs BPC-157: Side-by-Side Comparison (2026)" description: "Compare LL-37 vs BPC-157 — mechanism, half-life, dose range, side effects, and live vendor pricing. LL-37 from $45.00. BPC-157 from $29.00. Side-by-side data" lang: en json-ld: | [ { "@context": "https://schema.org", "@type": "BreadcrumbList", "itemListElement": [ { "@type": "ListItem", "position": 1, "name": "Home", "item": "https://www.bodyhackguide.co/" }, { "@type": "ListItem", "position": 2, "name": "Compare", "item": "https://www.bodyhackguide.co/compare" }, { "@type": "ListItem", "position": 3, "name": "LL-37 vs BPC-157" } ] }, { "@context": "https://schema.org", "@type": "WebPage", "name": "LL-37 vs BPC-157: Side-by-Side Comparison (2026)", "description": "Compare LL-37 vs BPC-157 — mechanism, half-life, dose range, side effects, and live vendor pricing. LL-37 from $45.00. BPC-157 from $29.00. Side-by-side data from BodyHackGuide — we earn a commission on some vendor links.", "url": "https://www.bodyhackguide.co/compare/ll-37-vs-bpc-157", "dateModified": "2026-09-07", "isPartOf": { "@type": "WebSite", "name": "BodyHackGuide", "url": "https://www.bodyhackguide.co" }, "mainEntity": { "@type": "ItemList", "itemListElement": [ { "@type": "ListItem", "position": 1, "item": { "@type": "Product", "name": "LL-37", "description": "LL-37 is the only human cathelicidin, a 37-amino-acid amphipathic alpha-helical peptide ([LL-37, 37 aa]) cleaved from the C-terminus of the 170-amino-acid precursor hCAP-18 (human cationic antimicrobial protein, 18 kDa), which is encoded by the CAMP gene on chromosome 3p21.31.…", "url": "https://www.bodyhackguide.co/compound/ll-37", "category": "Immune & Inflammation", "offers": { "@type": "AggregateOffer", "lowPrice": "45.00", "priceCurrency": "USD", "offerCount": 2 } } }, { "@type": "ListItem", "position": 2, "item": { "@type": "Product", "name": "BPC-157", "description": "BPC-157 (Body Protection Compound-157) is a synthetic pentadecapeptide consisting of 15 amino acids (Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val) derived from a partial sequence of human gastric juice protein BPC. It has a molecular weight of 1419.53 Da and a CAS number of…", "url": "https://www.bodyhackguide.co/compound/bpc-157", "category": "Injury, Repair & Recovery", "offers": { "@type": "AggregateOffer", "lowPrice": "29.00", "priceCurrency": "USD", "offerCount": 17 } } } ] } }, { "@context": "https://schema.org", "@type": "Organization", "@id": "https://www.bodyhackguide.co#organization", "name": "BodyHackGuide", "alternateName": "BHG", "url": "https://www.bodyhackguide.co", "logo": { "@type": "ImageObject", "url": "https://www.bodyhackguide.co/logo.png", "width": 512, "height": 512 }, "description": "Evidence-based research reference for peptides and nootropics. 124+ compound profiles, interactive dosing calculators, real-time vendor pricing, and trust-scored vendor reviews scored on a public, reproducible methodology applied to every vendor. BodyHackGuide and BHG Labs share common ownership, and we earn a commission on purchases through our links.", "foundingDate": "2024", "founder": { "@id": "https://www.bodyhackguide.co/about#person" }, "sameAs": [ "https://x.com/bodyhackguide", "https://reddit.com/r/BodyHackGuide", "https://reddit.com/r/BrainHackGuide", "https://reddit.com/r/Biohackingher", "https://discord.gg/Mhq5UdRYBA" ], "knowsAbout": [ "Peptide research", "Nootropic research", "Biohacking", "Compound dosing", "Vendor transparency" ], "publishingPrinciples": "https://www.bodyhackguide.co/editorial-standards", "ethicsPolicy": "https://www.bodyhackguide.co/editorial-standards", "diversityPolicy": "https://www.bodyhackguide.co/editorial-standards" }, { "@context": "https://schema.org", "@type": "FAQPage", "mainEntity": [ { "@type": "Question", "name": "What's the difference between LL-37 and BPC-157?", "acceptedAnswer": { "@type": "Answer", "text": "LL-37 is a immune & inflammation that ll-37's biological activity spans three functional categories: direct antimicrobial, immunomodulatory, and tissue-remodeling. each operates through partially distinct mechanisms.…. BPC-157 is a injury, repair & recovery that nitric oxide (no) system modulation bpc-157 exerts a central integrative effect through modulation of the nitric oxide system. studies by seiwerth et al. (2022) demonstrated that…. The two differ in mechanism, half-life (~30 minutes (free peptide; rapidly cleared by proteolysis). Human pharmacokinetics of exogenous LL-37 are not well characterized. vs Short plasma half-life. The first formal preclinical ADME study reported an elimination half-life under ~30 minutes after IV/IM dosing in rats and dogs, with linear dose-proportional kinetics (PMID: 36588717); a 2026 biopharmaceutical review confirms this sub-30-minute plasma half-life and highlights a pharmacokinetic-pharmacodynamic disconnect, as biological effects persist for hours to days (PMID: 42198317). No full human pharmacokinetic study has been published; twice-daily dosing is empirical/community-standard rather than PK-derived.), and typical dose range." } }, { "@type": "Question", "name": "Which has the longer half-life, LL-37 or BPC-157?", "acceptedAnswer": { "@type": "Answer", "text": "LL-37 has a half-life of ~30 minutes (free peptide; rapidly cleared by proteolysis). Human pharmacokinetics of exogenous LL-37 are not well characterized.. BPC-157 has a half-life of Short plasma half-life. The first formal preclinical ADME study reported an elimination half-life under ~30 minutes after IV/IM dosing in rats and dogs, with linear dose-proportional kinetics (PMID: 36588717); a 2026 biopharmaceutical review confirms this sub-30-minute plasma half-life and highlights a pharmacokinetic-pharmacodynamic disconnect, as biological effects persist for hours to days (PMID: 42198317). No full human pharmacokinetic study has been published; twice-daily dosing is empirical/community-standard rather than PK-derived.. Longer half-lives generally mean less frequent dosing but slower on/off kinetics." } }, { "@type": "Question", "name": "Which is cheaper, LL-37 or BPC-157?", "acceptedAnswer": { "@type": "Answer", "text": "Current lowest live price on BodyHackGuide: LL-37 from $45.00, BPC-157 from $29.00. Prices are pulled from the vendor listings tracked on BHG and change frequently — see the compare tables on each compound page for the current set of offers." } }, { "@type": "Question", "name": "Can you stack LL-37 and BPC-157?", "acceptedAnswer": { "@type": "Answer", "text": "Stacking depends on mechanism overlap, safety profile, and goals. LL-37 and BPC-157 should only be stacked after reviewing each compound's individual protocol page, side effect profile, and any published interaction data. Use the BodyHackGuide stack builder for a structured review before combining research compounds." } } ] } ] --- [Skip to content](#main-content) ## Research Use Only This site is an **educational resource** for research compounds. We do **not endorse** human consumption of any compound. BodyHackGuide and **BHG Labs share common ownership**; we rank every vendor on the same public methodology, and we earn a commission on purchases through our links. By entering, you confirm you are **21 years of age or older** and agree to our [Terms](/terms) & [Privacy Policy](/privacy). I'm 21+ — Enter SiteLeave site [![BodyHackGuide](/assets/bodyhackguide-logo-DOzZNUyh.webp)BodyHackGuide ](/) [Compare](/compare)[Wiki](/wiki)[Vendors](/vendors)[Deals](/deals)[Stacks](/stack-builder)[Nootropics](/nootropics)[Tools](/tools) Learn Community Search ⌘K [Sign In](/auth?returnTo=%2Fcompare%2Fll-37-vs-bpc-157) 100K+ researchers trust BodyHackGuide — Join [r/BodyHackGuide](https://reddit.com/r/bodyhackguide) 1. [Home](/) 2. [Compare](/compare) 3. LL-37 vs BPC-157 # LL-37 vs BPC-157 Side-by-side comparison of LL-37 and BPC-157: mechanism, half-life, dose range, safety profile, and live vendor pricing. Updated continuously as new research and listings land. LL-37 from $45.00 BPC-157 from $29.00 ## Live price snapshot ### LL-37 Current low $49.99 as of Sep 5, 2026 7-day low $49.99 30-day low $49.99 30-day change — baseline building ### BPC-157 Current low $34.99 as of Sep 5, 2026 7-day low $34.99 30-day low $34.99 30-day change — baseline building ## LL-37 LL-37 is the only human cathelicidin, a 37-amino-acid amphipathic alpha-helical peptide ([LL-37, 37 aa]) cleaved from the C-terminus of the 170-amino-acid precursor hCAP-18 (human cationic… **Live lowest price:** $45.00 across 2 vendors [Full LL-37 profile](/compound/ll-37) ## BPC-157 Featured BPC-157 (Body Protection Compound-157) is a synthetic pentadecapeptide consisting of 15 amino acids (Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val) derived from a partial sequence of human gastric juice… **Live lowest price:** $29.00 across 17 vendors [Full BPC-157 profile](/compound/bpc-157) ## Side-by-side comparison Attribute LL-37 BPC-157 Category Immune & Inflammation Injury, Repair & Recovery Research Stage Clinical Preclinical Mechanism of Action LL-37's biological activity spans three functional categories: direct antimicrobial, immunomodulatory, and tissue-remodeling. Each operates through partially distinct mechanisms. Direct Antimicrobial Mechanism (Membrane Disruption): LL-37 is a cationic… Nitric Oxide (NO) System Modulation BPC-157 exerts a central integrative effect through modulation of the nitric oxide system. Studies by Seiwerth et al. (2022) demonstrated that BPC-157 counteracts both NO-excess and NO-deficiency states, functioning as a… Half-Life ~30 minutes (free peptide; rapidly cleared by proteolysis). Human pharmacokinetics of exogenous LL-37 are not well characterized. Short plasma half-life. The first formal preclinical ADME study reported an elimination half-life under ~30 minutes after IV/IM dosing in rats and dogs, with linear dose-proportional kinetics (PMID: 36588717); a 2026 biopharmaceutical review confirms this sub-30-minute plasma half-life and highlights a pharmacokinetic-pharmacodynamic disconnect, as biological effects persist for hours to days (PMID: 42198317). No full human pharmacokinetic study has been published; twice-daily dosing is empirical/community-standard rather than PK-derived. Typical Dose Range — 200-500 mcg subcutaneous 1-2x daily (community protocols); 1-10 mcg/kg in animal studies Dosing Frequency — Twice daily (AM and PM) for optimal serum levels; once daily acceptable Administration — Subcutaneous, Oral, Intraperitoneal, Intravenous Side Effects LL-37 has a less benign side-effect profile than many peptides covered in this guide, reflecting its mechanistic potency and narrow therapeutic window. Common (injection site): - Injection site irritation — more pronounced than with most peptides. Redness,… Generally well-tolerated. Mild nausea or GI discomfort during initial use. Temporary increase in pain/inflammation at injury site (healing response). Rare: drowsiness, dizziness, mild headache. Very rare: transient changes in blood pressure. Molecular Weight 4493.4 g/mol 1419.5 g/mol (average); molecular formula C62H98N16O22 Common Vial Sizes — 5mg, 10mg ## Price History 3 data points - VANDL Labs - Ion Peptide - Disguised Alpha ## Price History 8 data points - OF - BM - Unknown - VANDL Labs - Unknown - LB - Ion Peptide - Disguised Alpha ### LL-37 — potential benefits - Broad-spectrum antimicrobial activity - Wound healing acceleration - Biofilm disruption - Immune system modulation - Anti-inflammatory effects - Gut barrier support ### BPC-157 — potential benefits - Accelerated tendon and ligament healing with improved biomechanical strength in preclinical soft-tissue injury models (PMID: 30915550) - Gastric and GI mucosal cytoprotection against ethanol-induced lesions, mediated in part by the nitric oxide system (PMID: 30279308) - Healing of cysteamine-induced colitis and colon anastomosis in preclinical inflammatory bowel disease models (PMID: 24304574) - Neuroprotection with dopaminergic and nitric oxide-system modulation in central nervous system injury models such as stroke and dopamine-receptor blockade (PMID: 34380875) - Promotion of angiogenesis via VEGFR2 up-regulation, internalization, and VEGFR2-Akt-eNOS signaling in rat hind-limb ischemia and endothelial assays (PMID: 27847966) - Tendon fibroblast outgrowth, cell survival, and migration through FAK-paxillin pathway activation (PMID: 21030672) - Growth hormone receptor up-regulation in tendon fibroblasts, potentiating growth hormone's proliferative effect (PMID: 25415472) - Nitric oxide-system interaction with endothelium protection, angiogenesis, and EGR-1-mediated growth-factor and collagen expression (PMID: 22300085) ## Frequently asked ### What's the difference between LL-37 and BPC-157? LL-37 is a immune & inflammation that ll-37's biological activity spans three functional categories: direct antimicrobial, immunomodulatory, and tissue-remodeling. each operates through partially distinct mechanisms.…. BPC-157 is a injury, repair & recovery that nitric oxide (no) system modulation bpc-157 exerts a central integrative effect through modulation of the nitric oxide system. studies by seiwerth et al. (2022) demonstrated that…. The two differ in mechanism, half-life (~30 minutes (free peptide; rapidly cleared by proteolysis). Human pharmacokinetics of exogenous LL-37 are not well characterized. vs Short plasma half-life. The first formal preclinical ADME study reported an elimination half-life under ~30 minutes after IV/IM dosing in rats and dogs, with linear dose-proportional kinetics (PMID: 36588717); a 2026 biopharmaceutical review confirms this sub-30-minute plasma half-life and highlights a pharmacokinetic-pharmacodynamic disconnect, as biological effects persist for hours to days (PMID: 42198317). No full human pharmacokinetic study has been published; twice-daily dosing is empirical/community-standard rather than PK-derived.), and typical dose range. ### Which has the longer half-life, LL-37 or BPC-157? LL-37 has a half-life of ~30 minutes (free peptide; rapidly cleared by proteolysis). Human pharmacokinetics of exogenous LL-37 are not well characterized.. BPC-157 has a half-life of Short plasma half-life. The first formal preclinical ADME study reported an elimination half-life under ~30 minutes after IV/IM dosing in rats and dogs, with linear dose-proportional kinetics (PMID: 36588717); a 2026 biopharmaceutical review confirms this sub-30-minute plasma half-life and highlights a pharmacokinetic-pharmacodynamic disconnect, as biological effects persist for hours to days (PMID: 42198317). No full human pharmacokinetic study has been published; twice-daily dosing is empirical/community-standard rather than PK-derived.. Longer half-lives generally mean less frequent dosing but slower on/off kinetics. ### Which is cheaper, LL-37 or BPC-157? Current lowest live price on BodyHackGuide: LL-37 from $45.00, BPC-157 from $29.00. Prices are pulled from the vendor listings tracked on BHG and change frequently — see the compare tables on each compound page for the current set of offers. ### Can you stack LL-37 and BPC-157? Stacking depends on mechanism overlap, safety profile, and goals. LL-37 and BPC-157 should only be stacked after reviewing each compound's individual protocol page, side effect profile, and any published interaction data. Use the BodyHackGuide stack builder for a structured review before combining research compounds. ## See current vendor prices Live listings from the vendors we track, refreshed continuously. [LL-37 prices](/compound/ll-37?tab=prices) [BPC-157 prices](/compound/bpc-157?tab=prices) [Compare all compounds](/compare) ### Before you buy LL-37 or BPC-157 Check the vendor trust score. Every supplier we track is rated 0–100 on COA verification, payment transparency, shipping, reviews, and listings — one published, reproducible methodology, applied to every vendor including BHG Labs, which shares our ownership. [View Vendor Scorecard](/vendors/scorecard) ## Related comparisons [BPC-157 vs TB-500](/compare/bpc-157-vs-tb-500)[Thymosin-Alpha-1 vs BPC-157](/compare/thymosin-alpha-1-vs-bpc-157)[KPV vs BPC-157](/compare/kpv-vs-bpc-157)[LL-37 vs Thymosin-Alpha-1](/compare/ll-37-vs-thymosin-alpha-1)[TB-500 vs Thymosin-Alpha-1](/compare/tb-500-vs-thymosin-alpha-1) **Research use only.** BodyHackGuide is a research and price-comparison reference. BodyHackGuide and BHG Labs share common ownership. The compounds discussed on this page are not approved by the FDA for human consumption and are sold strictly for laboratory research. Prices shown are pulled from vendor listings tracked on BHG and are subject to change. We earn an affiliate commission on some outbound clicks, and every vendor is ranked on the same public, reproducible methodology. See [editorial standards](/editorial-standards) and [affiliate disclosure](/affiliate-disclosure). ![BodyHackGuide](/assets/bodyhackguide-logo-DOzZNUyh.webp) ### BodyHackGuide Your biohacking research hub — compound pricing, brain health protocols, dosing tools, and vendor reviews. [support@bodyhackguide.co](mailto:support@bodyhackguide.co) [](https://discord.gg/Mhq5UdRYBA)[](https://reddit.com/r/BodyHackGuide)[](https://x.com/bodyhackguide) Explore #### Explore - [Compare prices](/compare) - [Research suppliers](/vendors) - [Deals](/deals) - [Coupons](/coupons) - [Nootropics](/nootropics) - [Brain health](/brain-health) - [Blog](/blog) - [Guides](/guides) Tools #### Tools - [Reconstitution](/tools/reconstitution) - [Dosage calculator](/tools/dosage) - [Half-life visualizer](/tools/halflife) - [COA lookup](/tools/coa) - [Cost calculator](/tools/cost-calculator) - [Stack builder](/stack-builder) - [All tools →](/tools) Trust & vendors #### Trust & vendors - [Vendor directory](/vendors) - [Trust scorecard](/vendors/scorecard) - [Get BHG verified](/vendors/get-vetted) - [Scoring methodology](/vendors/methodology) - [Peptide cheatsheet](/guides/peptide-cheat-sheet-download) Company #### Company - [About](/about) - [Affiliate disclosure](/affiliate-disclosure) - [Editorial standards](/editorial-standards) - [Creators](/creators) - [Coaches](/coaches) - [Privacy](/privacy) - [Terms](/terms) - [Full site directory →](/site-directory) **Ownership & Affiliate Disclosure:** BodyHackGuide and BHG Labs share common ownership. We rank every vendor on the same public, reproducible [methodology](/vendors/methodology), and we earn a commission from purchases made through our links at no extra cost to you. Full details in our [affiliate disclosure](/affiliate-disclosure). **Research Disclaimer:** All compounds listed are for laboratory and research purposes only. Not for human consumption. This site does not sell, distribute, or promote any products. Always consult a qualified healthcare professional and comply with local regulations. © 2026 BodyHackGuide. All rights reserved. · [Terms](/terms) · [Privacy](/privacy) [Shop BHG Labs · 20% off with BHG20](https://bhglabs.co/shop/?utm_source=reddit&utm_medium=paid&utm_campaign=bhg20_bridge&utm_content=sticky_mobile_bar&ref=zmgqyxku&coupon=BHG20) hi 👋