---
title: "Best Peptides for Recovery &amp; Healing — 2026 Buyer's Guide"
description: "Top-ranked peptides for recovery &amp; healing in 2026. Mechanism, dosing, and live vendor pricing for BPC-157, TB-500, BPC-157/TB-500 Blend and more. Updated"
lang: en
json-ld: |
  [
    {
      "@context": "https://schema.org",
      "@type": "BreadcrumbList",
      "itemListElement": [
        {
          "@type": "ListItem",
          "position": 1,
          "name": "Home",
          "item": "https://www.bodyhackguide.co/"
        },
        {
          "@type": "ListItem",
          "position": 2,
          "name": "Compare",
          "item": "https://www.bodyhackguide.co/compare"
        },
        {
          "@type": "ListItem",
          "position": 3,
          "name": "Best Peptides for Recovery & Healing"
        }
      ]
    },
    {
      "@context": "https://schema.org",
      "@type": "BreadcrumbList",
      "itemListElement": [
        {
          "@type": "ListItem",
          "position": 1,
          "name": "Home",
          "item": "https://www.bodyhackguide.co"
        },
        {
          "@type": "ListItem",
          "position": 2,
          "name": "Best Of",
          "item": "https://www.bodyhackguide.co/compare"
        },
        {
          "@type": "ListItem",
          "position": 3,
          "name": "Best Peptides for Recovery & Healing",
          "item": "https://www.bodyhackguide.co/best/peptides-for-recovery"
        }
      ]
    },
    {
      "@context": "https://schema.org",
      "@type": "ItemList",
      "name": "Best Peptides for Recovery & Healing",
      "itemListElement": [
        {
          "@type": "ListItem",
          "position": 1,
          "item": {
            "@type": "Drug",
            "name": "BPC-157",
            "url": "https://www.bodyhackguide.co/compound/bpc-157",
            "description": "BPC-157 (Body Protection Compound-157) is a synthetic pentadecapeptide consisting of 15 amino acids (Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val) derived from a partial sequence of hum"
          }
        },
        {
          "@type": "ListItem",
          "position": 2,
          "item": {
            "@type": "Drug",
            "name": "TB-500",
            "url": "https://www.bodyhackguide.co/compound/tb-500",
            "description": "TB-500 is the name the market and the FDA use for a short synthetic fragment of thymosin beta-4: the seven-amino-acid, N-acetylated actin-binding sequence Ac-LKKTETQ (residues 17 to 23). Thymosin beta"
          }
        },
        {
          "@type": "ListItem",
          "position": 3,
          "item": {
            "@type": "Drug",
            "name": "BPC-157/TB-500 Blend",
            "url": "https://www.bodyhackguide.co/compound/bpc-tb-blend",
            "description": "Combined healing peptide blend"
          }
        },
        {
          "@type": "ListItem",
          "position": 4,
          "item": {
            "@type": "Drug",
            "name": "GHK-Cu",
            "url": "https://www.bodyhackguide.co/compound/ghk-cu",
            "description": "GHK-Cu is the copper(II) complex of the tripeptide glycyl-L-histidyl-L-lysine, a molecule Pickart and Thaler first pulled out of human plasma in 1973. The free peptide (GHK, C14H24N6O4) weighs about 3"
          }
        },
        {
          "@type": "ListItem",
          "position": 5,
          "item": {
            "@type": "Drug",
            "name": "KPV",
            "url": "https://www.bodyhackguide.co/compound/kpv",
            "description": "KPV is a three-amino-acid peptide — Lysine-Proline-Valine — that makes up the C-terminal tail of alpha-MSH (alpha-melanocyte-stimulating hormone). With a molecular weight of only 342.4 Da, it is one o"
          }
        },
        {
          "@type": "ListItem",
          "position": 6,
          "item": {
            "@type": "Drug",
            "name": "PDRN",
            "url": "https://www.bodyhackguide.co/compound/pdrn",
            "description": "PDRN (Polydeoxyribonucleotide) is a biotechnological compound derived from salmon sperm DNA (Oncorhynchus mykiss) through extraction, purification, and fractionation. It consists of polynucleotide cha"
          }
        },
        {
          "@type": "ListItem",
          "position": 7,
          "item": {
            "@type": "Drug",
            "name": "Thymosin Alpha-1 (TA1)",
            "url": "https://www.bodyhackguide.co/compound/thymosin-alpha-1",
            "description": "Thymosin alpha-1 (Tα1) is a 28-amino-acid N-acetylated peptide (N-Ac-Ser-Asp-Ala-Ala-Val-Asp-Thr-Ser-Ser-Glu-Ile-Thr-Thr-Lys-Asp-Leu-Lys-Glu-Lys-Lys-Glu-Val-Val-Glu-Glu-Ala-Glu-Asn) isolated and chara"
          }
        },
        {
          "@type": "ListItem",
          "position": 8,
          "item": {
            "@type": "Drug",
            "name": "Thymalin",
            "url": "https://www.bodyhackguide.co/compound/thymalin",
            "description": "Thymalin is a thymus-derived peptide complex developed in the 1970s by Vladimir Khavinson and the Leningrad (now St. Petersburg) Institute of Bioregulation and Gerontology as part of a broader program"
          }
        },
        {
          "@type": "ListItem",
          "position": 9,
          "item": {
            "@type": "Drug",
            "name": "Thymogen",
            "url": "https://www.bodyhackguide.co/compound/thymogen",
            "description": "Thymogen (also transliterated **Timogen** or **╨ó╨╕╨╝╨╛╨│╨╡╨╜**) is a **synthetic dipeptide — glutamyl-tryptophan (Glu-Trp, or EW)** — developed by the St Petersburg Institute of Bioregulation and Ger"
          }
        },
        {
          "@type": "ListItem",
          "position": 10,
          "item": {
            "@type": "Drug",
            "name": "LL-37",
            "url": "https://www.bodyhackguide.co/compound/ll-37",
            "description": "LL-37 is the only human cathelicidin, a 37-amino-acid amphipathic alpha-helical peptide ([LL-37, 37 aa]) cleaved from the C-terminus of the 170-amino-acid precursor hCAP-18 (hum"
          }
        },
        {
          "@type": "ListItem",
          "position": 11,
          "item": {
            "@type": "Drug",
            "name": "Humanin",
            "url": "https://www.bodyhackguide.co/compound/humanin",
            "description": "Humanin is a 24-amino-acid peptide (MAPRGFSCLLLLTSEIDLPVKRRA) encoded within the mitochondrial 16S ribosomal RNA gene and translated from a short open reading frame that was not recognized as biologic"
          }
        },
        {
          "@type": "ListItem",
          "position": 12,
          "item": {
            "@type": "Drug",
            "name": "ARA-290",
            "url": "https://www.bodyhackguide.co/compound/ara-290",
            "description": "ARA-290, also known as Cibinetide or pHBSP (Helix B Surface Peptide), is an 11-amino-acid peptide — QEQLERALNSS — designed to mimic a specific region of the tissue-protective surface of erythropoietin"
          }
        },
        {
          "@type": "ListItem",
          "position": 13,
          "item": {
            "@type": "Drug",
            "name": "IGF-1 LR3",
            "url": "https://www.bodyhackguide.co/compound/igf-1-lr3",
            "description": "IGF-1 LR3 (Long R3 IGF-1) is a synthetic analog of human insulin-like growth factor 1 modified at two positions to dramatically extend its serum half-life and amplify its tissue bioactivity compared t"
          }
        },
        {
          "@type": "ListItem",
          "position": 14,
          "item": {
            "@type": "Drug",
            "name": "PEG-MGF",
            "url": "https://www.bodyhackguide.co/compound/peg-mgf",
            "description": "PEG-MGF (Pegylated Mechano Growth Factor) is a synthetic, PEGylated form of Mechano Growth Factor (MGF) — an alternatively spliced variant of IGF-1 produced locally in muscle and other tissues in resp"
          }
        },
        {
          "@type": "ListItem",
          "position": 15,
          "item": {
            "@type": "Drug",
            "name": "Cartalax",
            "url": "https://www.bodyhackguide.co/compound/cartalax",
            "description": "\nCartalax is a short synthetic peptide developed in Russia by Vladimir Khavinson and colleagues at the St. Petersburg Institute of Bioregulation and Gerontology, positioned as a \"cartilage bioregulato"
          }
        },
        {
          "@type": "ListItem",
          "position": 16,
          "item": {
            "@type": "Drug",
            "name": "Pinealon",
            "url": "https://www.bodyhackguide.co/compound/pinealon",
            "description": "Pinealon is a **synthetic tripeptide — glutamyl-aspartyl-arginine (Glu-Asp-Arg, or EDR)** — developed by the St Petersburg Institute of Bioregulation and Gerontology (IBG) under the leadership of **Pr"
          }
        },
        {
          "@type": "ListItem",
          "position": 17,
          "item": {
            "@type": "Drug",
            "name": "Livagen",
            "url": "https://www.bodyhackguide.co/compound/livagen",
            "description": "\nLivagen is a short synthetic peptide developed in Russia by Vladimir Khavinson and his collaborators at the St. Petersburg Institute of Bioregulation and Gerontology, positioned as a \"liver bioregula"
          }
        },
        {
          "@type": "ListItem",
          "position": 18,
          "item": {
            "@type": "Drug",
            "name": "Cordyceps",
            "url": "https://www.bodyhackguide.co/compound/cordyceps",
            "description": "**Cordyceps** is a genus of parasitic fungi (order Hypocreales, family Cordycipitaceae) historically prized in traditional Tibetan, Chinese, and Bhutanese medicine for their purported abilities to res"
          }
        }
      ]
    },
    {
      "@context": "https://schema.org",
      "@type": "FAQPage",
      "mainEntity": [
        {
          "@type": "Question",
          "name": "What are the best peptides for recovery & healing?",
          "acceptedAnswer": {
            "@type": "Answer",
            "text": "The top-ranked peptides for recovery & healing based on research evidence and current vendor pricing are: 1) BPC-157, 2) TB-500, 3) BPC-157/TB-500 Blend, 4) GHK-Cu, 5) KPV. Each is profiled below with mechanism, dosing, and the cheapest current source."
          }
        },
        {
          "@type": "Question",
          "name": "Which peptide works fastest for recovery & healing?",
          "acceptedAnswer": {
            "@type": "Answer",
            "text": "Onset varies by mechanism. Direct-acting compounds (e.g., metabolic agonists for fat loss, healing peptides for tissue repair) typically show effects within 2-4 weeks of consistent dosing. Adaptogenic and longevity compounds operate on slower 8-12 week timelines. Each compound profile has its own onset notes — see the linked research pages for specifics."
          }
        },
        {
          "@type": "Question",
          "name": "Where to buy peptides for recovery & healing?",
          "acceptedAnswer": {
            "@type": "Answer",
            "text": "BodyHackGuide tracks live vendor pricing across every compound on this page. Each row links to the buyer-intent /buy/<compound> page where vendors are ranked cheapest-first by price per mg, with active coupon codes surfaced. Trust Score rubric (0-100) filters out low-quality vendors before they're surfaced anywhere."
          }
        },
        {
          "@type": "Question",
          "name": "Are these peptides legal to buy?",
          "acceptedAnswer": {
            "@type": "Answer",
            "text": "All compounds linked here are sold by vendors for research-use-only — no prescription required for research purchases. None of the vendors on BodyHackGuide sell research compounds for human consumption. BodyHackGuide editorial doesn't promote off-label use; we provide research data so qualified researchers can make informed sourcing decisions."
          }
        }
      ]
    }
  ]
---

[Skip to content](#main-content)

## Research Use Only

This site is an **educational resource** for research compounds. We do **not endorse** human consumption of any compound. BodyHackGuide and **BHG Labs share common ownership**; we rank every vendor on the same public methodology, and we earn a commission on purchases through our links. By entering, you confirm you are **21 years of age or older** and agree to our [Terms](/terms) & [Privacy Policy](/privacy).

I'm 21+ — Enter SiteLeave site

  

[![BodyHackGuide](/assets/bodyhackguide-logo-DOzZNUyh.webp)BodyHackGuide ](/)

[Compare](/compare)[Wiki](/wiki)[Vendors](/vendors)[Deals](/deals)[Stacks](/stack-builder)[Nootropics](/nootropics)[Tools](/tools)

Learn

Community

Search ⌘K

[Sign In](/auth?returnTo=%2Fbest%2Fpeptides-for-joint-pain)

100K+ researchers trust BodyHackGuide — Join [r/BodyHackGuide](https://reddit.com/r/bodyhackguide) 

1.  [Home](/)

3.  [Compare](/compare)

5.  Best Peptides for Recovery & Healing 

💪 

2026 Buyer's Guide

# Best Peptides for Recovery & Healing — 2026

Top-ranked peptides for recovery & healing based on research evidence and current vendor availability. Each compound below links to its full research profile, live vendor pricing, and active coupon codes. Peptides and compounds studied for tissue repair, healing, and regeneration.

## Top 18 peptides for recovery & healing

1

### BPC-157

Injury, Repair & Recovery  Top pick 

BPC-157 (Body Protection Compound-157) is a synthetic pentadecapeptide consisting of 15 amino acids (Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val) derived from a partial sequence of human gastric juice protein BPC. It has a molecular weight of 1419.53 Da and a CAS …

Cheapest: **$34.99** at **BioMyst Labs** · $7.00/mg · 14 active listings 

[Where to buy](/buy/bpc-157) [Research profile](/compound/bpc-157)[Coupon codes](/coupons/bpc-157)

2

### TB-500

Injury, Repair & Recovery 

TB-500 is the name the market and the FDA use for a short synthetic fragment of thymosin beta-4: the seven-amino-acid, N-acetylated actin-binding sequence Ac-LKKTETQ (residues 17 to 23). Thymosin beta-4 itself is a 43-amino-acid peptide (about 4963 Da acetylated) and one of the m…

Cheapest: **$29.00** at **Ion Peptide** · $5.80/mg · 8 active listings 

[Where to buy](/buy/tb-500) [Research profile](/compound/tb-500)[Coupon codes](/coupons/tb-500)

3

### BPC-157/TB-500 Blend

Recovery 

Combined healing peptide blend

Cheapest: **$49.99** at **VANDL Labs** · $5.00/mg · 6 active listings 

[Where to buy](/buy/bpc-tb-blend) [Research profile](/compound/bpc-tb-blend)[Coupon codes](/coupons/bpc-tb-blend)

4

### GHK-Cu

Skin, Hair & Aesthetics 

GHK-Cu is the copper(II) complex of the tripeptide glycyl-L-histidyl-L-lysine, a molecule Pickart and Thaler first pulled out of human plasma in 1973. The free peptide (GHK, C14H24N6O4) weighs about 340.4 Da; bind it 1:1 to copper and you get the neutral GHK-Cu complex (C14H22CuN…

Cheapest: **$34.99** at **Optimum Formula** · $0.70/mg · 7 active listings 

[Where to buy](/buy/ghk-cu) [Research profile](/compound/ghk-cu)[Coupon codes](/coupons/ghk-cu)

5

### KPV

Recovery 

KPV is a three-amino-acid peptide — Lysine-Proline-Valine — that makes up the C-terminal tail of alpha-MSH (alpha-melanocyte-stimulating hormone). With a molecular weight of only 342.4 Da, it is one of the smallest peptides in the research space, yet it preserves much of the anti…

Cheapest: **$34.99** at **VANDL Labs** · $7.00/mg · 7 active listings 

[Where to buy](/buy/kpv) [Research profile](/compound/kpv)[Coupon codes](/coupons/kpv)

6

### PDRN

Skin & Hair 

PDRN (Polydeoxyribonucleotide) is a biotechnological compound derived from salmon sperm DNA (Oncorhynchus mykiss) through extraction, purification, and fractionation. It consists of polynucleotide chains with molecular weights ranging from 50 to 1500 kDa. PDRN is widely used in A…

Cheapest: **$34.95** at **Ion Peptide** · 1 active listing 

[Where to buy](/buy/pdrn) [Research profile](/compound/pdrn)[Coupon codes](/coupons/pdrn)

7

### Thymosin Alpha-1 (TA1)

Immune & Inflammation 

Thymosin alpha-1 (Tα1) is a 28-amino-acid N-acetylated peptide (N-Ac-Ser-Asp-Ala-Ala-Val-Asp-Thr-Ser-Ser-Glu-Ile-Thr-Thr-Lys-Asp-Leu-Lys-Glu-Lys-Lys-Glu-Val-Val-Glu-Glu-Ala-Glu-Asn) isolated and characterized by Allan Goldstein's laboratory at George Washington University in the …

Cheapest: **$39.99** at **VANDL Labs** · $8.00/mg · 4 active listings 

[Where to buy](/buy/thymosin-alpha-1) [Research profile](/compound/thymosin-alpha-1)[Coupon codes](/coupons/thymosin-alpha-1)

8

### Thymalin

Peptides 

Thymalin is a thymus-derived peptide complex developed in the 1970s by Vladimir Khavinson and the Leningrad (now St. Petersburg) Institute of Bioregulation and Gerontology as part of a broader program to identify tissue-specific regulatory peptides from mammalian organs. Produced…

Cheapest: **$44.99** at **Disguised Alpha** · $4.50/mg · 2 active listings 

[Where to buy](/buy/thymalin) [Research profile](/compound/thymalin)[Coupon codes](/coupons/thymalin)

9

### Thymogen

Recovery 

Thymogen (also transliterated \*\*Timogen\*\* or \*\*╨ó╨╕╨╝╨╛╨│╨╡╨╜\*\*) is a \*\*synthetic dipeptide — glutamyl-tryptophan (Glu-Trp, or EW)\*\* — developed by the St Petersburg Institute of Bioregulation and Gerontology under Professor Vladimir Khavinson. Thymogen belongs to the same family…

[Where to buy](/buy/thymogen) [Research profile](/compound/thymogen)[Coupon codes](/coupons/thymogen)

10

### LL-37

Immune & Inflammation 

LL-37 is the only human cathelicidin, a 37-amino-acid amphipathic alpha-helical peptide ([LL-37, 37 aa]) cleaved from the C-terminus of the 170-amino-acid precursor hCAP-18 (human cationic antimicrobial protein, 18 kDa), which is encoded by the CAMP gene on…

Cheapest: **$45.00** at **Ion Peptide** · $9.00/mg · 2 active listings 

[Where to buy](/buy/ll-37) [Research profile](/compound/ll-37)[Coupon codes](/coupons/ll-37)

11

### Humanin

Recovery 

Humanin is a 24-amino-acid peptide (MAPRGFSCLLLLTSEIDLPVKRRA) encoded within the mitochondrial 16S ribosomal RNA gene and translated from a short open reading frame that was not recognized as biologically active until 2001, when Hashimoto and colleagues identified it in a screen …

Cheapest: **$44.99** at **Limitless Biochem EU** · $4.50/mg · 2 active listings 

[Where to buy](/buy/humanin) [Research profile](/compound/humanin)[Coupon codes](/coupons/humanin)

12

### ARA-290

Recovery 

ARA-290, also known as Cibinetide or pHBSP (Helix B Surface Peptide), is an 11-amino-acid peptide — QEQLERALNSS — designed to mimic a specific region of the tissue-protective surface of erythropoietin (EPO) without activating the classical hematopoietic EPO receptor that drives r…

Cheapest: **$49.99** at **Limitless Biochem EU** · $5.00/mg · 2 active listings 

[Where to buy](/buy/ara-290) [Research profile](/compound/ara-290)[Coupon codes](/coupons/ara-290)

13

### IGF-1 LR3

Growth Hormone / IGF-1 Axis 

IGF-1 LR3 (Long R3 IGF-1) is a synthetic analog of human insulin-like growth factor 1 modified at two positions to dramatically extend its serum half-life and amplify its tissue bioactivity compared to native IGF-1. The "LR3" designation describes the two key modifications: - \*\*…

Cheapest: **$49.99** at **ResearchChemHQ** · $49.99/mg · 5 active listings 

[Where to buy](/buy/igf-1-lr3) [Research profile](/compound/igf-1-lr3)[Coupon codes](/coupons/igf-1-lr3)

14

### PEG-MGF

Performance 

PEG-MGF (Pegylated Mechano Growth Factor) is a synthetic, PEGylated form of Mechano Growth Factor (MGF) — an alternatively spliced variant of IGF-1 produced locally in muscle and other tissues in response to mechanical loading or damage. MGF differs from systemic IGF-1 in that it…

Cheapest: **$39.00** at **Ion Peptide** · $19.50/mg · 1 active listing 

[Where to buy](/buy/peg-mgf) [Research profile](/compound/peg-mgf)[Coupon codes](/coupons/peg-mgf)

15

### Cartalax

Recovery 

Cartalax is a short synthetic peptide developed in Russia by Vladimir Khavinson and colleagues at the St. Petersburg Institute of Bioregulation and Gerontology, positioned as a "cartilage bioregulator" intended to support chondrocyte function, cartilage matrix synthesis, and joi…

Cheapest: **$34.99** at **Limitless Biochem EU** · $1.75/mg · 3 active listings 

[Where to buy](/buy/cartalax) [Research profile](/compound/cartalax)[Coupon codes](/coupons/cartalax)

16

### Pinealon

Nootropics 

Pinealon is a \*\*synthetic tripeptide — glutamyl-aspartyl-arginine (Glu-Asp-Arg, or EDR)\*\* — developed by the St Petersburg Institute of Bioregulation and Gerontology (IBG) under the leadership of \*\*Professor Vladimir Khavinson\*\*, the dominant figure in what is collectively known …

Cheapest: **$36.99** at **GetMelts** · $7.40/mg · 4 active listings 

[Where to buy](/buy/pinealon) [Research profile](/compound/pinealon)[Coupon codes](/coupons/pinealon)

17

### Livagen

Recovery 

Livagen is a short synthetic peptide developed in Russia by Vladimir Khavinson and his collaborators at the St. Petersburg Institute of Bioregulation and Gerontology, positioned as a "liver bioregulator" intended to normalise age-related and stress-related changes in hepatic tis…

[Where to buy](/buy/livagen) [Research profile](/compound/livagen)[Coupon codes](/coupons/livagen)

18

### Cordyceps

Adaptogen 

\*\*Cordyceps\*\* is a genus of parasitic fungi (order Hypocreales, family Cordycipitaceae) historically prized in traditional Tibetan, Chinese, and Bhutanese medicine for their purported abilities to restore vitality, improve athletic performance, support respiratory and kidney func…

[Where to buy](/buy/cordyceps) [Research profile](/compound/cordyceps)[Coupon codes](/coupons/cordyceps)

[

Recovery & Healing hub

Browse every compound tagged for recovery & healing, including stack ideas.

](/goal/recovery)[

Compare prices

Real-time vendor pricing across every tracked research compound.

](/compare)[

Trust Score rubric

The 0-100 vendor scoring system used to filter every link on this page.

](/vendors/methodology)

## Best peptides for recovery & healing — FAQ

### What are the best peptides for recovery & healing?

The top-ranked peptides for recovery & healing based on research evidence and current vendor pricing are: 1) BPC-157, 2) TB-500, 3) BPC-157/TB-500 Blend, 4) GHK-Cu, 5) KPV. Each is profiled below with mechanism, dosing, and the cheapest current source.

### Which peptide works fastest for recovery & healing?

Onset varies by mechanism. Direct-acting compounds (e.g., metabolic agonists for fat loss, healing peptides for tissue repair) typically show effects within 2-4 weeks of consistent dosing. Adaptogenic and longevity compounds operate on slower 8-12 week timelines. Each compound profile has its own onset notes — see the linked research pages for specifics.

### Where to buy peptides for recovery & healing?

BodyHackGuide tracks live vendor pricing across every compound on this page. Each row links to the buyer-intent /buy/<compound> page where vendors are ranked cheapest-first by price per mg, with active coupon codes surfaced. Trust Score rubric (0-100) filters out low-quality vendors before they're surfaced anywhere.

### Are these peptides legal to buy?

All compounds linked here are sold by vendors for research-use-only — no prescription required for research purchases. None of the vendors on BodyHackGuide sell research compounds for human consumption. BodyHackGuide editorial doesn't promote off-label use; we provide research data so qualified researchers can make informed sourcing decisions.

**Affiliate disclosure.** BodyHackGuide may earn a commission from purchases via links on this page — at no additional cost to you. Compound rankings are based on research-evidence strength and live vendor data; we don't accept payment for editorial placement. See our full [affiliate disclosure](/affiliate-disclosure) .

![BodyHackGuide](/assets/bodyhackguide-logo-DOzZNUyh.webp)

### BodyHackGuide

Your biohacking research hub — compound pricing, brain health protocols, dosing tools, and vendor reviews.

[support@bodyhackguide.co](mailto:support@bodyhackguide.co)

[](https://discord.gg/Mhq5UdRYBA)[](https://reddit.com/r/BodyHackGuide)[](https://x.com/bodyhackguide)

Explore

#### Explore

-   [Compare prices](/compare)
-   [Research suppliers](/vendors)
-   [Deals](/deals)
-   [Coupons](/coupons)
-   [Nootropics](/nootropics)
-   [Brain health](/brain-health)
-   [Blog](/blog)
-   [Guides](/guides)

Tools

#### Tools

-   [Reconstitution](/tools/reconstitution)
-   [Dosage calculator](/tools/dosage)
-   [Half-life visualizer](/tools/halflife)
-   [COA lookup](/tools/coa)
-   [Cost calculator](/tools/cost-calculator)
-   [Stack builder](/stack-builder)
-   [All tools →](/tools)

Trust & vendors

#### Trust & vendors

-   [Vendor directory](/vendors)
-   [Trust scorecard](/vendors/scorecard)
-   [Get BHG verified](/vendors/get-vetted)
-   [Scoring methodology](/vendors/methodology)
-   [Peptide cheatsheet](/guides/peptide-cheat-sheet-download)

Company

#### Company

-   [About](/about)
-   [Affiliate disclosure](/affiliate-disclosure)
-   [Editorial standards](/editorial-standards)
-   [Creators](/creators)
-   [Coaches](/coaches)
-   [Privacy](/privacy)
-   [Terms](/terms)
-   [Full site directory →](/site-directory)

**Ownership & Affiliate Disclosure:** BodyHackGuide and BHG Labs share common ownership. We rank every vendor on the same public, reproducible [methodology](/vendors/methodology), and we earn a commission from purchases made through our links at no extra cost to you. Full details in our [affiliate disclosure](/affiliate-disclosure).

**Research Disclaimer:** All compounds listed are for laboratory and research purposes only. Not for human consumption. This site does not sell, distribute, or promote any products. Always consult a qualified healthcare professional and comply with local regulations.

© 2026 BodyHackGuide. All rights reserved. · [Terms](/terms) · [Privacy](/privacy)

[Shop BHG Labs · 20% off with BHG20](https://bhglabs.co/shop/?utm_source=reddit&utm_medium=paid&utm_campaign=bhg20_bridge&utm_content=sticky_mobile_bar&ref=zmgqyxku&coupon=BHG20)

hi 👋